FGF8_MOUSE
ID FGF8_MOUSE Reviewed; 268 AA.
AC P37237;
DT 01-OCT-1994, integrated into UniProtKB/Swiss-Prot.
DT 01-OCT-1994, sequence version 1.
DT 03-AUG-2022, entry version 179.
DE RecName: Full=Fibroblast growth factor 8;
DE Short=FGF-8;
DE AltName: Full=Androgen-induced growth factor;
DE Short=AIGF;
DE AltName: Full=Heparin-binding growth factor 8;
DE Short=HBGF-8;
DE Flags: Precursor;
GN Name=Fgf8; Synonyms=Aigf;
OS Mus musculus (Mouse).
OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC Murinae; Mus; Mus.
OX NCBI_TaxID=10090;
RN [1]
RP NUCLEOTIDE SEQUENCE [MRNA], AND PARTIAL PROTEIN SEQUENCE.
RX PubMed=1409588; DOI=10.1073/pnas.89.19.8928;
RA Tanaka A., Miyamoto K., Minamino N., Takeda M., Sato B., Matsuo H.,
RA Matsumoto K.;
RT "Cloning and characterization of an androgen-induced growth factor
RT essential for the androgen-dependent growth of mouse mammary carcinoma
RT cells.";
RL Proc. Natl. Acad. Sci. U.S.A. 89:8928-8932(1992).
RN [2]
RP NUCLEOTIDE SEQUENCE [MRNA], AND FUNCTION.
RC TISSUE=Mammary carcinoma;
RX PubMed=7884899; DOI=10.1128/jvi.69.4.2501-2507.1995;
RA Macarthur C.A., Shankar D.B., Shackleford G.M.;
RT "Fgf-8, activated by proviral insertion, cooperates with the Wnt-1
RT transgene in murine mammary tumorigenesis.";
RL J. Virol. 69:2501-2507(1995).
RN [3]
RP NUCLEOTIDE SEQUENCE [MRNA].
RX PubMed=7583127; DOI=10.1016/s0960-9822(95)00157-6;
RA Mahmood R., Bresnick J., Hornbruch A., Mahony C., Morton N., Colquhoun K.,
RA Martin P., Lumsden A., Dickson C., Mason I.;
RT "A role for FGF-8 in the initiation and maintenance of vertebrate limb bud
RT outgrowth.";
RL Curr. Biol. 5:797-806(1995).
CC -!- FUNCTION: Plays an important role in the regulation of embryonic
CC development, cell proliferation, cell differentiation and cell
CC migration. Required for normal brain, eye, ear and limb development
CC during embryogenesis. Required for normal development of the
CC gonadotropin-releasing hormone (GnRH) neuronal system. Plays a role in
CC neurite outgrowth in hippocampal cells (By similarity). Cooperates with
CC Wnt-1 in mouse mammary tumor virus-induced murine mammary tumorigenesis
CC (PubMed:7884899). {ECO:0000250|UniProtKB:P55075,
CC ECO:0000269|PubMed:7884899}.
CC -!- SUBUNIT: Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and
CC FGFR4. Affinity between fibroblast growth factors (FGFs) and their
CC receptors is increased by heparan sulfate glycosaminoglycans that
CC function as coreceptors (By similarity). {ECO:0000250}.
CC -!- SUBCELLULAR LOCATION: Secreted.
CC -!- ALTERNATIVE PRODUCTS:
CC Event=Alternative splicing; Named isoforms=3;
CC Comment=Additional isoforms seem to exist.;
CC Name=FGF-8C;
CC IsoId=P37237-1; Sequence=Displayed;
CC Name=FGF-8B;
CC IsoId=P37237-2; Sequence=VSP_001527;
CC Name=FGF-8A;
CC IsoId=P37237-3; Sequence=VSP_001528;
CC -!- TISSUE SPECIFICITY: Absent in normal mammary glands and detected only
CC in adult testis and ovary and in midgestational embryos.
CC -!- INDUCTION: By androgens.
CC -!- PTM: The N-terminus is blocked.
CC -!- SIMILARITY: Belongs to the heparin-binding growth factors family.
CC {ECO:0000305}.
CC ---------------------------------------------------------------------------
CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
CC Distributed under the Creative Commons Attribution (CC BY 4.0) License
CC ---------------------------------------------------------------------------
DR EMBL; D12483; BAA02051.1; -; mRNA.
DR EMBL; D12482; BAA02050.1; -; mRNA.
DR EMBL; U18673; AAA65387.1; -; mRNA.
DR EMBL; Z48746; CAA88637.1; -; mRNA.
DR CCDS; CCDS29864.1; -. [P37237-1]
DR CCDS; CCDS50450.1; -. [P37237-3]
DR CCDS; CCDS50451.1; -. [P37237-2]
DR PIR; A46245; A46245.
DR PIR; B46245; B46245.
DR RefSeq; NP_001159834.1; NM_001166362.1. [P37237-2]
DR RefSeq; NP_001159835.1; NM_001166363.1. [P37237-3]
DR RefSeq; NP_034335.1; NM_010205.2. [P37237-1]
DR AlphaFoldDB; P37237; -.
DR SMR; P37237; -.
DR DIP; DIP-6030N; -.
DR IntAct; P37237; 1.
DR STRING; 10090.ENSMUSP00000026241; -.
DR GlyGen; P37237; 2 sites.
DR PhosphoSitePlus; P37237; -.
DR PaxDb; P37237; -.
DR PRIDE; P37237; -.
DR Antibodypedia; 31323; 413 antibodies from 36 providers.
DR DNASU; 14179; -.
DR Ensembl; ENSMUST00000026241; ENSMUSP00000026241; ENSMUSG00000025219. [P37237-1]
DR Ensembl; ENSMUST00000111927; ENSMUSP00000107558; ENSMUSG00000025219. [P37237-3]
DR Ensembl; ENSMUST00000111928; ENSMUSP00000107559; ENSMUSG00000025219. [P37237-2]
DR GeneID; 14179; -.
DR KEGG; mmu:14179; -.
DR UCSC; uc008hrh.2; mouse. [P37237-3]
DR UCSC; uc012bmo.1; mouse. [P37237-1]
DR CTD; 2253; -.
DR MGI; MGI:99604; Fgf8.
DR VEuPathDB; HostDB:ENSMUSG00000025219; -.
DR eggNOG; KOG3885; Eukaryota.
DR GeneTree; ENSGT00940000159518; -.
DR HOGENOM; CLU_090682_0_1_1; -.
DR InParanoid; P37237; -.
DR PhylomeDB; P37237; -.
DR TreeFam; TF331233; -.
DR Reactome; R-MMU-109704; PI3K Cascade.
DR Reactome; R-MMU-1257604; PIP3 activates AKT signaling.
DR Reactome; R-MMU-190322; FGFR4 ligand binding and activation.
DR Reactome; R-MMU-190371; FGFR3b ligand binding and activation.
DR Reactome; R-MMU-190372; FGFR3c ligand binding and activation.
DR Reactome; R-MMU-190373; FGFR1c ligand binding and activation.
DR Reactome; R-MMU-190375; FGFR2c ligand binding and activation.
DR Reactome; R-MMU-5654219; Phospholipase C-mediated cascade: FGFR1.
DR Reactome; R-MMU-5654221; Phospholipase C-mediated cascade, FGFR2.
DR Reactome; R-MMU-5654227; Phospholipase C-mediated cascade, FGFR3.
DR Reactome; R-MMU-5654228; Phospholipase C-mediated cascade, FGFR4.
DR Reactome; R-MMU-5654687; Downstream signaling of activated FGFR1.
DR Reactome; R-MMU-5654688; SHC-mediated cascade:FGFR1.
DR Reactome; R-MMU-5654689; PI-3K cascade:FGFR1.
DR Reactome; R-MMU-5654693; FRS-mediated FGFR1 signaling.
DR Reactome; R-MMU-5654695; PI-3K cascade:FGFR2.
DR Reactome; R-MMU-5654699; SHC-mediated cascade:FGFR2.
DR Reactome; R-MMU-5654700; FRS-mediated FGFR2 signaling.
DR Reactome; R-MMU-5654704; SHC-mediated cascade:FGFR3.
DR Reactome; R-MMU-5654706; FRS-mediated FGFR3 signaling.
DR Reactome; R-MMU-5654710; PI-3K cascade:FGFR3.
DR Reactome; R-MMU-5654712; FRS-mediated FGFR4 signaling.
DR Reactome; R-MMU-5654719; SHC-mediated cascade:FGFR4.
DR Reactome; R-MMU-5654720; PI-3K cascade:FGFR4.
DR Reactome; R-MMU-5654726; Negative regulation of FGFR1 signaling.
DR Reactome; R-MMU-5654727; Negative regulation of FGFR2 signaling.
DR Reactome; R-MMU-5654732; Negative regulation of FGFR3 signaling.
DR Reactome; R-MMU-5654733; Negative regulation of FGFR4 signaling.
DR Reactome; R-MMU-5658623; FGFRL1 modulation of FGFR1 signaling.
DR Reactome; R-MMU-5673001; RAF/MAP kinase cascade.
DR Reactome; R-MMU-6811558; PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling.
DR BioGRID-ORCS; 14179; 1 hit in 75 CRISPR screens.
DR ChiTaRS; Fgf8; mouse.
DR PRO; PR:P37237; -.
DR Proteomes; UP000000589; Chromosome 19.
DR RNAct; P37237; protein.
DR Bgee; ENSMUSG00000025219; Expressed in external ectoderm and 186 other tissues.
DR ExpressionAtlas; P37237; baseline and differential.
DR Genevisible; P37237; MM.
DR GO; GO:0005737; C:cytoplasm; IBA:GO_Central.
DR GO; GO:0009897; C:external side of plasma membrane; ISO:MGI.
DR GO; GO:0005615; C:extracellular space; ISO:MGI.
DR GO; GO:0042056; F:chemoattractant activity; ISO:MGI.
DR GO; GO:0005104; F:fibroblast growth factor receptor binding; IBA:GO_Central.
DR GO; GO:0008083; F:growth factor activity; ISO:MGI.
DR GO; GO:0005105; F:type 1 fibroblast growth factor receptor binding; ISO:MGI.
DR GO; GO:0005111; F:type 2 fibroblast growth factor receptor binding; ISO:MGI.
DR GO; GO:0009887; P:animal organ morphogenesis; IBA:GO_Central.
DR GO; GO:0035909; P:aorta morphogenesis; IGI:MGI.
DR GO; GO:0006915; P:apoptotic process; IMP:MGI.
DR GO; GO:0001974; P:blood vessel remodeling; IGI:MGI.
DR GO; GO:0060348; P:bone development; ISO:MGI.
DR GO; GO:0001569; P:branching involved in blood vessel morphogenesis; IGI:MGI.
DR GO; GO:0060445; P:branching involved in salivary gland morphogenesis; IMP:MGI.
DR GO; GO:0001658; P:branching involved in ureteric bud morphogenesis; IMP:MGI.
DR GO; GO:0030154; P:cell differentiation; IBA:GO_Central.
DR GO; GO:0045165; P:cell fate commitment; IGI:MGI.
DR GO; GO:0090134; P:cell migration involved in mesendoderm migration; IMP:MGI.
DR GO; GO:0008283; P:cell population proliferation; IMP:MGI.
DR GO; GO:0021846; P:cell proliferation in forebrain; IMP:MGI.
DR GO; GO:0021954; P:central nervous system neuron development; ISO:MGI.
DR GO; GO:0060128; P:corticotropin hormone secreting cell differentiation; IDA:MGI.
DR GO; GO:0007368; P:determination of left/right symmetry; IMP:MGI.
DR GO; GO:0071542; P:dopaminergic neuron differentiation; ISO:MGI.
DR GO; GO:0033563; P:dorsal/ventral axon guidance; ISO:MGI.
DR GO; GO:0009953; P:dorsal/ventral pattern formation; IBA:GO_Central.
DR GO; GO:0009792; P:embryo development ending in birth or egg hatching; IMP:MGI.
DR GO; GO:0035050; P:embryonic heart tube development; IMP:MGI.
DR GO; GO:0035116; P:embryonic hindlimb morphogenesis; IGI:MGI.
DR GO; GO:0048702; P:embryonic neurocranium morphogenesis; IGI:MGI.
DR GO; GO:0003198; P:epithelial to mesenchymal transition involved in endocardial cushion formation; IDA:MGI.
DR GO; GO:0008543; P:fibroblast growth factor receptor signaling pathway; IDA:MGI.
DR GO; GO:0021798; P:forebrain dorsal/ventral pattern formation; IMP:MGI.
DR GO; GO:0048853; P:forebrain morphogenesis; IMP:MGI.
DR GO; GO:0021884; P:forebrain neuron development; ISO:MGI.
DR GO; GO:0048699; P:generation of neurons; IMP:MGI.
DR GO; GO:0008406; P:gonad development; ISO:MGI.
DR GO; GO:0007507; P:heart development; IMP:MGI.
DR GO; GO:0001947; P:heart looping; IMP:MGI.
DR GO; GO:0003007; P:heart morphogenesis; IMP:MGI.
DR GO; GO:0042472; P:inner ear morphogenesis; IGI:MGI.
DR GO; GO:0001822; P:kidney development; IMP:MGI.
DR GO; GO:0120223; P:larynx morphogenesis; IGI:MGI.
DR GO; GO:0035108; P:limb morphogenesis; IGI:MGI.
DR GO; GO:0030324; P:lung development; IMP:MGI.
DR GO; GO:0060425; P:lung morphogenesis; IMP:MGI.
DR GO; GO:0030539; P:male genitalia development; IDA:MGI.
DR GO; GO:0000165; P:MAPK cascade; IMP:MGI.
DR GO; GO:0008078; P:mesodermal cell migration; IMP:MGI.
DR GO; GO:0001656; P:metanephros development; IEA:Ensembl.
DR GO; GO:0030917; P:midbrain-hindbrain boundary development; IMP:MGI.
DR GO; GO:0140014; P:mitotic nuclear division; IDA:MGI.
DR GO; GO:0008045; P:motor neuron axon guidance; ISO:MGI.
DR GO; GO:0043066; P:negative regulation of apoptotic process; IMP:MGI.
DR GO; GO:0055026; P:negative regulation of cardiac muscle tissue development; ISO:MGI.
DR GO; GO:0043524; P:negative regulation of neuron apoptotic process; IMP:MGI.
DR GO; GO:0001839; P:neural plate morphogenesis; IMP:MGI.
DR GO; GO:0060563; P:neuroepithelial cell differentiation; ISO:MGI.
DR GO; GO:0051402; P:neuron apoptotic process; IMP:MGI.
DR GO; GO:0030182; P:neuron differentiation; IBA:GO_Central.
DR GO; GO:0042476; P:odontogenesis; IEA:Ensembl.
DR GO; GO:0035265; P:organ growth; IMP:MGI.
DR GO; GO:0001759; P:organ induction; IGI:MGI.
DR GO; GO:0030916; P:otic vesicle formation; IGI:MGI.
DR GO; GO:0003151; P:outflow tract morphogenesis; IGI:MGI.
DR GO; GO:0003148; P:outflow tract septum morphogenesis; IGI:UniProtKB.
DR GO; GO:0021543; P:pallium development; IMP:MGI.
DR GO; GO:0060037; P:pharyngeal system development; IGI:MGI.
DR GO; GO:0051781; P:positive regulation of cell division; IEA:UniProtKB-KW.
DR GO; GO:0008284; P:positive regulation of cell population proliferation; IDA:MGI.
DR GO; GO:0070374; P:positive regulation of ERK1 and ERK2 cascade; IGI:MGI.
DR GO; GO:0045745; P:positive regulation of G protein-coupled receptor signaling pathway; IDA:MGI.
DR GO; GO:0010628; P:positive regulation of gene expression; IDA:MGI.
DR GO; GO:0045840; P:positive regulation of mitotic nuclear division; IDA:MGI.
DR GO; GO:0046622; P:positive regulation of organ growth; IMP:MGI.
DR GO; GO:0050731; P:positive regulation of peptidyl-tyrosine phosphorylation; IMP:MGI.
DR GO; GO:0001934; P:positive regulation of protein phosphorylation; IBA:GO_Central.
DR GO; GO:2000648; P:positive regulation of stem cell proliferation; IGI:MGI.
DR GO; GO:0030334; P:regulation of cell migration; IBA:GO_Central.
DR GO; GO:0042487; P:regulation of odontogenesis of dentin-containing tooth; IGI:MGI.
DR GO; GO:0006979; P:response to oxidative stress; ISO:MGI.
DR GO; GO:0023019; P:signal transduction involved in regulation of gene expression; IDA:MGI.
DR GO; GO:0072089; P:stem cell proliferation; IGI:MGI.
DR GO; GO:0021544; P:subpallium development; IMP:MGI.
DR GO; GO:0021537; P:telencephalon development; IMP:MGI.
DR GO; GO:0030878; P:thyroid gland development; IMP:MGI.
DR GO; GO:0060129; P:thyroid-stimulating hormone-secreting cell differentiation; IDA:MGI.
DR CDD; cd00058; FGF; 1.
DR InterPro; IPR028249; FGF8.
DR InterPro; IPR002209; Fibroblast_GF_fam.
DR InterPro; IPR008996; IL1/FGF.
DR PANTHER; PTHR11486; PTHR11486; 1.
DR PANTHER; PTHR11486:SF3; PTHR11486:SF3; 1.
DR Pfam; PF00167; FGF; 1.
DR SMART; SM00442; FGF; 1.
DR SUPFAM; SSF50353; SSF50353; 1.
DR PROSITE; PS00247; HBGF_FGF; 1.
PE 1: Evidence at protein level;
KW Alternative splicing; Developmental protein; Differentiation;
KW Direct protein sequencing; Glycoprotein; Growth factor; Mitogen;
KW Pyrrolidone carboxylic acid; Reference proteome; Secreted; Signal.
FT SIGNAL 1..22
FT /evidence="ECO:0000255"
FT CHAIN 23..268
FT /note="Fibroblast growth factor 8"
FT /id="PRO_0000008971"
FT REGION 29..87
FT /note="Disordered"
FT /evidence="ECO:0000256|SAM:MobiDB-lite"
FT COMPBIAS 71..85
FT /note="Basic and acidic residues"
FT /evidence="ECO:0000256|SAM:MobiDB-lite"
FT MOD_RES 23
FT /note="Pyrrolidone carboxylic acid"
FT /evidence="ECO:0000255"
FT CARBOHYD 60
FT /note="N-linked (GlcNAc...) asparagine"
FT /evidence="ECO:0000255"
FT CARBOHYD 190
FT /note="N-linked (GlcNAc...) asparagine"
FT /evidence="ECO:0000255"
FT VAR_SEQ 24..87
FT /note="Missing (in isoform FGF-8A)"
FT /evidence="ECO:0000305"
FT /id="VSP_001528"
FT VAR_SEQ 24..87
FT /note="VRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKE
FT QRDSVLPKVTQR -> VTVQSSPNFTQ (in isoform FGF-8B)"
FT /evidence="ECO:0000305"
FT /id="VSP_001527"
SQ SEQUENCE 268 AA; 30420 MW; 3330A9F342AD7109 CRC64;
MGSPRSALSC LLLHLLVLCL QAQVRSAAQK RGPGAGNPAD TLGQGHEDRP FGQRSRAGKN
FTNPAPNYPE EGSKEQRDSV LPKVTQRHVR EQSLVTDQLS RRLIRTYQLY SRTSGKHVQV
LANKRINAMA EDGDPFAKLI VETDTFGSRV RVRGAETGLY ICMNKKGKLI AKSNGKGKDC
VFTEIVLENN YTALQNAKYE GWYMAFTRKG RPRKGSKTRQ HQREVHFMKR LPRGHHTTEQ
SLRFEFLNYP PFTRSLRGSQ RTWAPEPR
