位置:首页 > 蛋白库 > RBM4_MOUSE
RBM4_MOUSE
ID   RBM4_MOUSE              Reviewed;         361 AA.
AC   Q8C7Q4; O08752; Q8BN66;
DT   12-APR-2005, integrated into UniProtKB/Swiss-Prot.
DT   01-MAR-2003, sequence version 1.
DT   03-AUG-2022, entry version 153.
DE   RecName: Full=RNA-binding protein 4;
DE   AltName: Full=Lark homolog;
DE            Short=mLark;
DE   AltName: Full=RNA-binding motif protein 4;
DE   AltName: Full=RNA-binding motif protein 4a;
GN   Name=Rbm4; Synonyms=Rbm4a;
OS   Mus musculus (Mouse).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
OX   NCBI_TaxID=10090;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
RX   PubMed=9169144; DOI=10.1006/geno.1997.4704;
RA   Jackson F.R., Banfi S., Guffanti A., Rossi E.;
RT   "A novel zinc finger-containing RNA-binding protein conserved from
RT   fruitflies to humans.";
RL   Genomics 41:444-452(1997).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
RC   STRAIN=C57BL/6J; TISSUE=Eye, and Spinal cord;
RX   PubMed=16141072; DOI=10.1126/science.1112014;
RA   Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
RA   Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
RA   Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.,
RA   Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R.,
RA   Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T.,
RA   Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A.,
RA   Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B.,
RA   Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M.,
RA   Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S.,
RA   Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
RA   Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D.,
RA   Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M.,
RA   Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H.,
RA   Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V.,
RA   Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S.,
RA   Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H.,
RA   Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N.,
RA   Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F.,
RA   Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G.,
RA   Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z.,
RA   Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
RA   Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
RA   Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S.,
RA   Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K.,
RA   Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R.,
RA   van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H.,
RA   Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M.,
RA   Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C.,
RA   Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S.,
RA   Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K.,
RA   Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M.,
RA   Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C.,
RA   Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A.,
RA   Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.;
RT   "The transcriptional landscape of the mammalian genome.";
RL   Science 309:1559-1563(2005).
RN   [3]
RP   RNA-BINDING.
RX   PubMed=16260624; DOI=10.1128/mcb.25.22.10111-10121.2005;
RA   Lin J.C., Tarn W.Y.;
RT   "Exon selection in alpha-tropomyosin mRNA is regulated by the antagonistic
RT   action of RBM4 and PTB.";
RL   Mol. Cell. Biol. 25:10111-10121(2005).
RN   [4]
RP   FUNCTION, INDUCTION, AND TISSUE SPECIFICITY.
RX   PubMed=17264215; DOI=10.1073/pnas.0607567104;
RA   Kojima S., Matsumoto K., Hirose M., Shimada M., Nagano M., Shigeyoshi Y.,
RA   Hoshino S., Ui-Tei K., Saigo K., Green C.B., Sakaki Y., Tei H.;
RT   "LARK activates posttranscriptional expression of an essential mammalian
RT   clock protein, PERIOD1.";
RL   Proc. Natl. Acad. Sci. U.S.A. 104:1859-1864(2007).
RN   [5]
RP   PHOSPHORYLATION, SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
RX   PubMed=19801630; DOI=10.1074/jbc.m109.032946;
RA   Lin J.C., Tarn W.Y.;
RT   "RNA-binding motif protein 4 translocates to cytoplasmic granules and
RT   suppresses translation via argonaute2 during muscle cell differentiation.";
RL   J. Biol. Chem. 284:34658-34665(2009).
RN   [6]
RP   TISSUE SPECIFICITY.
RX   PubMed=21518792; DOI=10.1083/jcb.201007131;
RA   Lin J.C., Tarn W.Y.;
RT   "RBM4 down-regulates PTB and antagonizes its activity in muscle cell-
RT   specific alternative splicing.";
RL   J. Cell Biol. 193:509-520(2011).
CC   -!- FUNCTION: RNA-binding factor involved in multiple aspects of cellular
CC       processes like alternative splicing of pre-mRNA and translation
CC       regulation. Modulates alternative 5'-splice site and exon selection.
CC       Acts as a muscle cell differentiation-promoting factor. Activates exon
CC       skipping of the PTB pre-mRNA during muscle cell differentiation.
CC       Antagonizes the activity of the splicing factor PTBP1 to modulate
CC       muscle cell-specific exon selection of alpha tropomyosin. Binds to
CC       intronic pyrimidine-rich sequence of the TPM1 and MAPT pre-mRNAs.
CC       Required for the translational activation of PER1 mRNA in response to
CC       circadian clock. Binds directly to the 3'-UTR of the PER1 mRNA. Exerts
CC       a suppressive activity on Cap-dependent translation via binding to CU-
CC       rich responsive elements within the 3'UTR of mRNAs, a process increased
CC       under stress conditions or during myocytes differentiation. Recruits
CC       EIF4A1 to stimulate IRES-dependent translation initiation in respons to
CC       cellular stress. Associates to internal ribosome entry segment (IRES)
CC       in target mRNA species under stress conditions. Plays a role for miRNA-
CC       guided RNA cleavage and translation suppression by promoting
CC       association of AGO2-containing miRNPs with their cognate target mRNAs.
CC       Associates with miRNAs during muscle cell differentiation. Binds
CC       preferentially to 5'-CGCGCG[GCA]-3' motif in vitro.
CC       {ECO:0000269|PubMed:17264215}.
CC   -!- SUBUNIT: Interacts with TNPO3; the interaction mediates nuclear import
CC       of the protein and is disrupted by nuclear Ran bound to GTP. Interacts
CC       with EIF4G1 and WT1. Interacts with EIF4A1; the interaction is
CC       modulated under stress-induced conditions. Interacts with AGO1.
CC       Interacts with AGO2; the interaction occurs under both cell
CC       proliferation and differentiation conditions and in an RNA- and
CC       phosphorylation-independent manner. Interacts with DDX5; the
CC       interaction occurs in an RNA-independent manner (By similarity).
CC       {ECO:0000250}.
CC   -!- SUBCELLULAR LOCATION: Nucleus {ECO:0000250}. Nucleus, nucleolus
CC       {ECO:0000250}. Nucleus speckle {ECO:0000250}. Cytoplasm {ECO:0000250}.
CC       Cytoplasmic granule {ECO:0000250}. Note=Undergoes continuous
CC       nucleocytoplasmic shuttling. Upon nuclear import colocalizes with SR
CC       proteins in nuclear speckles. Arsenite stress-induced phosphorylation
CC       increases its subcellular relocalization from the nucleus to the
CC       cytoplasm and to cytoplasmic stress granules (SG) via a p38 MAPK
CC       signaling pathway. Primarily localized in nucleus and nucleoli under
CC       cell growth conditions and accumulated in the cytoplasm and cytoplasm
CC       perinuclear granules upon muscle cell differentiation (By similarity).
CC       {ECO:0000250}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=1;
CC         IsoId=Q8C7Q4-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=Q8C7Q4-2; Sequence=VSP_013417, VSP_013418;
CC   -!- TISSUE SPECIFICITY: Expressed in the suprachiasmatic nucleus (SCN).
CC       Expressed in myocytes; expression gradually increases during muscle
CC       cell differentiation (at protein level). Expressed in the
CC       suprachiasmatic nucleus (SCN). {ECO:0000269|PubMed:17264215,
CC       ECO:0000269|PubMed:19801630, ECO:0000269|PubMed:21518792}.
CC   -!- INDUCTION: Accumulates according to a circadian rhythm in the SCN.
CC       {ECO:0000269|PubMed:17264215}.
CC   -!- PTM: Phosphorylated. Phosphorylated in vitro on Ser-306 by SRPK1.
CC       Phosphorylation on Ser-306 is induced upon cell stress signaling, which
CC       alters its subcellular localization and may modulate its activity on
CC       IRES-mediated mRNA translation (By similarity). Phosphorylated.
CC       Phosphorylation on Ser-306 is induced upon cell muscle differentiation.
CC       {ECO:0000250, ECO:0000269|PubMed:19801630}.
CC   -!- MISCELLANEOUS: [Isoform 2]: May be due to an intron retention.
CC       {ECO:0000305}.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=AAC53171.1; Type=Frameshift; Evidence={ECO:0000305};
CC   ---------------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
CC   Distributed under the Creative Commons Attribution (CC BY 4.0) License
CC   ---------------------------------------------------------------------------
DR   EMBL; U89506; AAC53171.1; ALT_FRAME; mRNA.
DR   EMBL; AK049659; BAC33862.1; -; mRNA.
DR   EMBL; AK087488; BAC39895.1; -; mRNA.
DR   CCDS; CCDS29436.1; -. [Q8C7Q4-1]
DR   RefSeq; NP_001277051.1; NM_001290122.1. [Q8C7Q4-1]
DR   RefSeq; NP_001277052.1; NM_001290123.1. [Q8C7Q4-1]
DR   RefSeq; NP_001277053.1; NM_001290124.1.
DR   RefSeq; NP_001277054.1; NM_001290125.1.
DR   RefSeq; NP_033058.2; NM_009032.3. [Q8C7Q4-1]
DR   AlphaFoldDB; Q8C7Q4; -.
DR   SMR; Q8C7Q4; -.
DR   BioGRID; 202822; 2.
DR   BioGRID; 207870; 114.
DR   IntAct; Q8C7Q4; 1.
DR   STRING; 10090.ENSMUSP00000137345; -.
DR   iPTMnet; Q8C7Q4; -.
DR   PhosphoSitePlus; Q8C7Q4; -.
DR   EPD; Q8C7Q4; -.
DR   jPOST; Q8C7Q4; -.
DR   MaxQB; Q8C7Q4; -.
DR   PaxDb; Q8C7Q4; -.
DR   PRIDE; Q8C7Q4; -.
DR   DNASU; 19653; -.
DR   Ensembl; ENSMUST00000179189; ENSMUSP00000137174; ENSMUSG00000094936. [Q8C7Q4-1]
DR   Ensembl; ENSMUST00000180248; ENSMUSP00000137345; ENSMUSG00000094936. [Q8C7Q4-1]
DR   GeneID; 19653; -.
DR   KEGG; mmu:19653; -.
DR   UCSC; uc008gau.1; mouse. [Q8C7Q4-1]
DR   CTD; 5936; -.
DR   MGI; MGI:1100865; Rbm4.
DR   VEuPathDB; HostDB:ENSMUSG00000094936; -.
DR   eggNOG; KOG0109; Eukaryota.
DR   GeneTree; ENSGT00940000154421; -.
DR   HOGENOM; CLU_045263_0_0_1; -.
DR   InParanoid; Q8C7Q4; -.
DR   PhylomeDB; Q8C7Q4; -.
DR   TreeFam; TF320661; -.
DR   BioGRID-ORCS; 19653; 3 hits in 40 CRISPR screens.
DR   PRO; PR:Q8C7Q4; -.
DR   Proteomes; UP000000589; Chromosome 19.
DR   RNAct; Q8C7Q4; protein.
DR   Bgee; ENSMUSG00000094936; Expressed in cortical plate and 212 other tissues.
DR   ExpressionAtlas; Q8C7Q4; baseline and differential.
DR   Genevisible; Q8C7Q4; MM.
DR   GO; GO:0005737; C:cytoplasm; IDA:UniProtKB.
DR   GO; GO:0010494; C:cytoplasmic stress granule; ISS:UniProtKB.
DR   GO; GO:0005829; C:cytosol; ISO:MGI.
DR   GO; GO:0016607; C:nuclear speck; ISS:UniProtKB.
DR   GO; GO:0005730; C:nucleolus; IDA:UniProtKB.
DR   GO; GO:0005654; C:nucleoplasm; ISS:UniProtKB.
DR   GO; GO:0005634; C:nucleus; IDA:UniProtKB.
DR   GO; GO:0048471; C:perinuclear region of cytoplasm; IDA:UniProtKB.
DR   GO; GO:0030332; F:cyclin binding; ISO:MGI.
DR   GO; GO:0035198; F:miRNA binding; ISS:UniProtKB.
DR   GO; GO:0003730; F:mRNA 3'-UTR binding; IDA:UniProtKB.
DR   GO; GO:0003729; F:mRNA binding; ISO:MGI.
DR   GO; GO:0036002; F:pre-mRNA binding; IDA:UniProtKB.
DR   GO; GO:0097157; F:pre-mRNA intronic binding; ISS:UniProtKB.
DR   GO; GO:0097158; F:pre-mRNA intronic pyrimidine-rich binding; ISS:UniProtKB.
DR   GO; GO:0003723; F:RNA binding; ISS:UniProtKB.
DR   GO; GO:0008270; F:zinc ion binding; IEA:InterPro.
DR   GO; GO:0002190; P:cap-independent translational initiation; ISS:UniProtKB.
DR   GO; GO:0032922; P:circadian regulation of gene expression; IMP:MGI.
DR   GO; GO:0097167; P:circadian regulation of translation; IDA:UniProtKB.
DR   GO; GO:0035883; P:enteroendocrine cell differentiation; IMP:MGI.
DR   GO; GO:0043153; P:entrainment of circadian clock by photoperiod; IDA:UniProtKB.
DR   GO; GO:0042593; P:glucose homeostasis; IMP:MGI.
DR   GO; GO:0035773; P:insulin secretion involved in cellular response to glucose stimulus; IMP:MGI.
DR   GO; GO:0002192; P:IRES-dependent translational initiation of linear mRNA; ISS:UniProtKB.
DR   GO; GO:0035278; P:miRNA-mediated gene silencing by inhibition of translation; ISS:UniProtKB.
DR   GO; GO:0000398; P:mRNA splicing, via spliceosome; IBA:GO_Central.
DR   GO; GO:0017148; P:negative regulation of translation; ISS:UniProtKB.
DR   GO; GO:0032055; P:negative regulation of translation in response to stress; ISS:UniProtKB.
DR   GO; GO:0045947; P:negative regulation of translational initiation; ISS:UniProtKB.
DR   GO; GO:0031016; P:pancreas development; IMP:MGI.
DR   GO; GO:0051149; P:positive regulation of muscle cell differentiation; ISS:UniProtKB.
DR   GO; GO:0045727; P:positive regulation of translation; IDA:MGI.
DR   GO; GO:0000381; P:regulation of alternative mRNA splicing, via spliceosome; IMP:MGI.
DR   GO; GO:0010468; P:regulation of gene expression; IMP:MGI.
DR   GO; GO:0046626; P:regulation of insulin receptor signaling pathway; IDA:MGI.
DR   GO; GO:0046822; P:regulation of nucleocytoplasmic transport; IDA:UniProtKB.
DR   GO; GO:0046685; P:response to arsenic-containing substance; ISS:UniProtKB.
DR   CDD; cd12606; RRM1_RBM4; 1.
DR   CDD; cd12607; RRM2_RBM4; 1.
DR   Gene3D; 3.30.70.330; -; 2.
DR   InterPro; IPR012677; Nucleotide-bd_a/b_plait_sf.
DR   InterPro; IPR035979; RBD_domain_sf.
DR   InterPro; IPR034897; RBM4_RRM1.
DR   InterPro; IPR034898; RBM4_RRM2.
DR   InterPro; IPR000504; RRM_dom.
DR   InterPro; IPR001878; Znf_CCHC.
DR   Pfam; PF00076; RRM_1; 2.
DR   Pfam; PF00098; zf-CCHC; 1.
DR   SMART; SM00360; RRM; 2.
DR   SMART; SM00343; ZnF_C2HC; 1.
DR   SUPFAM; SSF54928; SSF54928; 2.
DR   PROSITE; PS50102; RRM; 2.
DR   PROSITE; PS50158; ZF_CCHC; 1.
PE   1: Evidence at protein level;
KW   Activator; Alternative splicing; Cytoplasm; Differentiation;
KW   Isopeptide bond; Metal-binding; mRNA processing; mRNA splicing; Nucleus;
KW   Phosphoprotein; Reference proteome; Repeat; RNA-binding;
KW   RNA-mediated gene silencing; Ubl conjugation; Zinc; Zinc-finger.
FT   CHAIN           1..361
FT                   /note="RNA-binding protein 4"
FT                   /id="PRO_0000081755"
FT   DOMAIN          2..72
FT                   /note="RRM 1"
FT                   /evidence="ECO:0000255|PROSITE-ProRule:PRU00176"
FT   DOMAIN          78..148
FT                   /note="RRM 2"
FT                   /evidence="ECO:0000255|PROSITE-ProRule:PRU00176"
FT   ZN_FING         160..177
FT                   /note="CCHC-type"
FT                   /evidence="ECO:0000255|PROSITE-ProRule:PRU00047"
FT   REGION          196..361
FT                   /note="Interaction with TNPO3"
FT                   /evidence="ECO:0000250"
FT   MOD_RES         86
FT                   /note="Phosphoserine"
FT                   /evidence="ECO:0000250|UniProtKB:Q9BWF3"
FT   MOD_RES         306
FT                   /note="Phosphoserine"
FT                   /evidence="ECO:0000250|UniProtKB:Q9BWF3"
FT   CROSSLNK        79
FT                   /note="Glycyl lysine isopeptide (Lys-Gly) (interchain with
FT                   G-Cter in SUMO2)"
FT                   /evidence="ECO:0000250|UniProtKB:Q9BWF3"
FT   VAR_SEQ         139..168
FT                   /note="KRMHVQLSTSRLRTAPGMGDQSGCYRCGKE -> ESLFWSAQYKAVRNELVE
FT                   KRKALGWKDFAG (in isoform 2)"
FT                   /evidence="ECO:0000303|PubMed:16141072"
FT                   /id="VSP_013417"
FT   VAR_SEQ         169..361
FT                   /note="Missing (in isoform 2)"
FT                   /evidence="ECO:0000303|PubMed:16141072"
FT                   /id="VSP_013418"
FT   CONFLICT        243
FT                   /note="S -> N (in Ref. 1; AAC53171)"
FT                   /evidence="ECO:0000305"
FT   CONFLICT        292
FT                   /note="A -> AAAAA (in Ref. 1; AAC53171)"
FT                   /evidence="ECO:0000305"
FT   CONFLICT        299
FT                   /note="S -> P (in Ref. 1; AAC53171)"
FT                   /evidence="ECO:0000305"
FT   CONFLICT        316
FT                   /note="L -> P (in Ref. 1; AAC53171)"
FT                   /evidence="ECO:0000305"
SQ   SEQUENCE   361 AA;  40046 MW;  D50BB51553AFA4E0 CRC64;
     MVKLFIGNLP REATEQEIRS LFEQYGKVLE CDIIKNYGFV HIEDKTAAED AIRNLHHYKL
     HGVNINVEAS KNKSKASTKL HVGNISPTCT NQELRAKFEE YGPVIECDIV KDYAFVHMER
     AEDAVEAIRG LDNTEFQGKR MHVQLSTSRL RTAPGMGDQS GCYRCGKEGH WSKECPIDRS
     GRVADLTEQY NEQYGAVRTP YTMSYGDSLY YNNTYGALDA YYKRCRAARS YEAVAAAAAS
     AYSNYAEQTL SQLPQVQNTA MASHLTSTSL DPYNRHLLPP SGAAAAAAAA AACTAASTSY
     YGRDRSPLRR ATGPVLTVGE GYGYGHDSEL SQASAAARNS LYDMARYERE QYADRARYSA
     F
 
 
维奥蛋白资源库 - 中文蛋白资源 CopyRight © 2010-2024