位置:首页 > 蛋白库 > ATPK_DROME
ATPK_DROME
ID   ATPK_DROME              Reviewed;         107 AA.
AC   Q9W141; A4VCL5; Q0E8W4; Q1ECC6;
DT   05-MAR-2002, integrated into UniProtKB/Swiss-Prot.
DT   01-MAY-2000, sequence version 1.
DT   03-AUG-2022, entry version 140.
DE   RecName: Full=Putative ATP synthase subunit f, mitochondrial {ECO:0000312|FlyBase:FBgn0035032};
GN   Name=ATPsynF {ECO:0000312|FlyBase:FBgn0035032};
GN   ORFNames=CG4692 {ECO:0000312|FlyBase:FBgn0035032};
OS   Drosophila melanogaster (Fruit fly).
OC   Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota;
OC   Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea;
OC   Drosophilidae; Drosophila; Sophophora.
OX   NCBI_TaxID=7227;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RC   STRAIN=Berkeley;
RX   PubMed=10731132; DOI=10.1126/science.287.5461.2185;
RA   Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D.,
RA   Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F.,
RA   George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N.,
RA   Sutton G.G., Wortman J.R., Yandell M.D., Zhang Q., Chen L.X., Brandon R.C.,
RA   Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D., Wan K.H., Doyle C.,
RA   Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G., Abril J.F., Agbayani A.,
RA   An H.-J., Andrews-Pfannkoch C., Baldwin D., Ballew R.M., Basu A.,
RA   Baxendale J., Bayraktaroglu L., Beasley E.M., Beeson K.Y., Benos P.V.,
RA   Berman B.P., Bhandari D., Bolshakov S., Borkova D., Botchan M.R., Bouck J.,
RA   Brokstein P., Brottier P., Burtis K.C., Busam D.A., Butler H., Cadieu E.,
RA   Center A., Chandra I., Cherry J.M., Cawley S., Dahlke C., Davenport L.B.,
RA   Davies P., de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I.,
RA   Dietz S.M., Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C.,
RA   Dunn P., Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S.,
RA   Fleischmann W., Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M.,
RA   Glasser K., Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M.,
RA   Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J., Hostin D.,
RA   Houston K.A., Howland T.J., Wei M.-H., Ibegwam C., Jalali M., Kalush F.,
RA   Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A., Kimmel B.E., Kodira C.D.,
RA   Kraft C.L., Kravitz S., Kulp D., Lai Z., Lasko P., Lei Y., Levitsky A.A.,
RA   Li J.H., Li Z., Liang Y., Lin X., Liu X., Mattei B., McIntosh T.C.,
RA   McLeod M.P., McPherson D., Merkulov G., Milshina N.V., Mobarry C.,
RA   Morris J., Moshrefi A., Mount S.M., Moy M., Murphy B., Murphy L.,
RA   Muzny D.M., Nelson D.L., Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R.,
RA   Pacleb J.M., Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V.,
RA   Reese M.G., Reinert K., Remington K., Saunders R.D.C., Scheeler F.,
RA   Shen H., Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J.,
RA   Spier E., Spradling A.C., Stapleton M., Strong R., Sun E., Svirskas R.,
RA   Tector C., Turner R., Venter E., Wang A.H., Wang X., Wang Z.-Y.,
RA   Wassarman D.A., Weinstock G.M., Weissenbach J., Williams S.M., Woodage T.,
RA   Worley K.C., Wu D., Yang S., Yao Q.A., Ye J., Yeh R.-F., Zaveri J.S.,
RA   Zhan M., Zhang G., Zhao Q., Zheng L., Zheng X.H., Zhong F.N., Zhong W.,
RA   Zhou X., Zhu S.C., Zhu X., Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M.,
RA   Venter J.C.;
RT   "The genome sequence of Drosophila melanogaster.";
RL   Science 287:2185-2195(2000).
RN   [2]
RP   GENOME REANNOTATION.
RC   STRAIN=Berkeley;
RX   PubMed=12537572; DOI=10.1186/gb-2002-3-12-research0083;
RA   Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S.,
RA   Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E.,
RA   Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P.,
RA   Bettencourt B.R., Celniker S.E., de Grey A.D.N.J., Drysdale R.A.,
RA   Harris N.L., Richter J., Russo S., Schroeder A.J., Shu S.Q., Stapleton M.,
RA   Yamada C., Ashburner M., Gelbart W.M., Rubin G.M., Lewis S.E.;
RT   "Annotation of the Drosophila melanogaster euchromatic genome: a systematic
RT   review.";
RL   Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
RC   STRAIN=Berkeley; TISSUE=Head;
RX   PubMed=12537569; DOI=10.1186/gb-2002-3-12-research0080;
RA   Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A.,
RA   Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M.,
RA   Celniker S.E.;
RT   "A Drosophila full-length cDNA resource.";
RL   Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A AND B).
RC   STRAIN=Berkeley; TISSUE=Head;
RA   Stapleton M., Carlson J.W., Chavez C., Frise E., Kapadia B., George R.A.,
RA   Pacleb J.M., Park S., Wan K.H., Yu C., Celniker S.E.;
RL   Submitted (APR-2007) to the EMBL/GenBank/DDBJ databases.
CC   -!- FUNCTION: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or
CC       Complex V) produces ATP from ADP in the presence of a proton gradient
CC       across the membrane which is generated by electron transport complexes
CC       of the respiratory chain. F-type ATPases consist of two structural
CC       domains, F(1) - containing the extramembraneous catalytic core and F(0)
CC       - containing the membrane proton channel, linked together by a central
CC       stalk and a peripheral stalk. During catalysis, ATP synthesis in the
CC       catalytic domain of F(1) is coupled via a rotary mechanism of the
CC       central stalk subunits to proton translocation. Part of the complex
CC       F(0) domain. Minor subunit located with subunit a in the membrane (By
CC       similarity). {ECO:0000250}.
CC   -!- SUBUNIT: F-type ATPases have 2 components, CF(1) - the catalytic core
CC       - and CF(0) - the membrane proton channel. CF(0) seems to have nine
CC       subunits: a, b, c, d, e, f, g, F6 and 8 (or A6L) (By similarity).
CC       {ECO:0000250}.
CC   -!- SUBCELLULAR LOCATION: Mitochondrion membrane {ECO:0000250}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=A;
CC         IsoId=Q9W141-1; Sequence=Displayed;
CC       Name=B;
CC         IsoId=Q9W141-2; Sequence=VSP_026521;
CC   -!- SIMILARITY: Belongs to the ATPase F chain family. {ECO:0000305}.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=ABF85708.1; Type=Erroneous initiation; Evidence={ECO:0000305};
CC   ---------------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
CC   Distributed under the Creative Commons Attribution (CC BY 4.0) License
CC   ---------------------------------------------------------------------------
DR   EMBL; AE013599; AAM68322.1; -; Genomic_DNA.
DR   EMBL; AY060738; AAL28286.1; -; mRNA.
DR   EMBL; BT025808; ABF85708.1; ALT_INIT; mRNA.
DR   EMBL; BT030456; ABP87898.1; -; mRNA.
DR   RefSeq; NP_611940.1; NM_138096.3. [Q9W141-1]
DR   RefSeq; NP_726463.1; NM_166678.3. [Q9W141-1]
DR   AlphaFoldDB; Q9W141; -.
DR   SMR; Q9W141; -.
DR   BioGRID; 63503; 36.
DR   DIP; DIP-21252N; -.
DR   IntAct; Q9W141; 1.
DR   STRING; 7227.FBpp0072246; -.
DR   PaxDb; Q9W141; -.
DR   PRIDE; Q9W141; -.
DR   DNASU; 37931; -.
DR   EnsemblMetazoa; FBtr0072339; FBpp0072246; FBgn0035032. [Q9W141-1]
DR   EnsemblMetazoa; FBtr0072340; FBpp0072247; FBgn0035032. [Q9W141-1]
DR   GeneID; 37931; -.
DR   KEGG; dme:Dmel_CG4692; -.
DR   CTD; 37931; -.
DR   FlyBase; FBgn0035032; ATPsynF.
DR   VEuPathDB; VectorBase:FBgn0035032; -.
DR   eggNOG; KOG4092; Eukaryota.
DR   GeneTree; ENSGT00940000175005; -.
DR   HOGENOM; CLU_156759_0_0_1; -.
DR   InParanoid; Q9W141; -.
DR   OMA; HKYVQPK; -.
DR   PhylomeDB; Q9W141; -.
DR   Reactome; R-DME-163210; Formation of ATP by chemiosmotic coupling.
DR   Reactome; R-DME-8949613; Cristae formation.
DR   BioGRID-ORCS; 37931; 1 hit in 1 CRISPR screen.
DR   ChiTaRS; ATPsynF; fly.
DR   GenomeRNAi; 37931; -.
DR   PRO; PR:Q9W141; -.
DR   Proteomes; UP000000803; Chromosome 2R.
DR   Bgee; FBgn0035032; Expressed in adult hindgut (Drosophila) and 49 other tissues.
DR   ExpressionAtlas; Q9W141; baseline and differential.
DR   Genevisible; Q9W141; DM.
DR   GO; GO:0005753; C:mitochondrial proton-transporting ATP synthase complex; IBA:GO_Central.
DR   GO; GO:0000276; C:mitochondrial proton-transporting ATP synthase complex, coupling factor F(o); ISS:FlyBase.
DR   GO; GO:0005739; C:mitochondrion; HDA:FlyBase.
DR   GO; GO:0042776; P:proton motive force-driven mitochondrial ATP synthesis; IBA:GO_Central.
DR   GO; GO:1902600; P:proton transmembrane transport; ISS:FlyBase.
DR   InterPro; IPR019344; F1F0-ATPsyn_F_prd.
DR   PANTHER; PTHR13080; PTHR13080; 1.
DR   Pfam; PF10206; WRW; 1.
PE   3: Inferred from homology;
KW   Alternative splicing; ATP synthesis; CF(0); Hydrogen ion transport;
KW   Ion transport; Membrane; Mitochondrion; Reference proteome; Transport.
FT   CHAIN           1..107
FT                   /note="Putative ATP synthase subunit f, mitochondrial"
FT                   /id="PRO_0000194829"
FT   VAR_SEQ         105..107
FT                   /note="KYH -> NTTKGRCPVVLHLQQILHFPQGVREAGNHH (in isoform
FT                   B)"
FT                   /evidence="ECO:0000303|Ref.4"
FT                   /id="VSP_026521"
SQ   SEQUENCE   107 AA;  12483 MW;  B3A49AE9DA37DF7B CRC64;
     MAFGDYPAEY NPKVHGPYDP ARFYGKADVP FGQVKLGEIG AWLGRRNKTP NAVAGAVSRA
     WWRWQHKYVF PKRAGIAPFF QLTVASMTFF YLINYTKLKH HRNYKYH
 
 
维奥蛋白资源库 - 中文蛋白资源 CopyRight © 2010-2026