B2CL1_CHICK
ID B2CL1_CHICK Reviewed; 229 AA.
AC Q07816; Q98908;
DT 01-FEB-1995, integrated into UniProtKB/Swiss-Prot.
DT 01-NOV-1997, sequence version 2.
DT 03-AUG-2022, entry version 163.
DE RecName: Full=Bcl-2-like protein 1;
DE Short=Bcl2-L-1;
DE AltName: Full=Apoptosis regulator Bcl-X;
GN Name=BCL2L1; Synonyms=BCL-X, BCLX;
OS Gallus gallus (Chicken).
OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC Phasianinae; Gallus.
OX NCBI_TaxID=9031;
RN [1]
RP NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM SHORT).
RX PubMed=8358789; DOI=10.1016/0092-8674(93)90508-n;
RA Boise L.H., Gonzalez-Garcia M., Postema C.E., Ding L., Lindsten T.,
RA Turka L.A., Mao X., Nunez G., Thompson C.B.;
RT "bcl-x, a bcl-2-related gene that functions as a dominant regulator of
RT apoptotic cell death.";
RL Cell 74:597-608(1993).
RN [2]
RP NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG).
RC STRAIN=Hubbard White Mountain; TISSUE=Testis;
RX PubMed=9110311;
RX DOI=10.1002/(sici)1098-2795(199705)47:1<26::aid-mrd4>3.0.co;2-s;
RA Vilagrasa X., Mezquita C., Mezquita J.;
RT "Differential expression of bcl-2 and bcl-x during chicken
RT spermatogenesis.";
RL Mol. Reprod. Dev. 47:26-29(1997).
CC -!- FUNCTION: Dominant regulator of apoptotic cell death. The long form
CC displays cell death repressor activity, whereas the short isoform
CC promotes apoptosis. Also acts as a regulator of G2 checkpoint and
CC progression to cytokinesis during mitosis (By similarity).
CC {ECO:0000250}.
CC -!- SUBCELLULAR LOCATION: Mitochondrion membrane {ECO:0000250}; Single-pass
CC membrane protein {ECO:0000250}. Nucleus membrane {ECO:0000250}; Single-
CC pass membrane protein {ECO:0000250}; Cytoplasmic side {ECO:0000250}.
CC Mitochondrion matrix {ECO:0000250}. Cytoplasm, cytoskeleton,
CC microtubule organizing center, centrosome {ECO:0000250}. Cytoplasm,
CC cytosol {ECO:0000250}. Cytoplasmic vesicle, secretory vesicle, synaptic
CC vesicle membrane {ECO:0000250}. Note=After neuronal stimulation,
CC translocates from cytosol to synaptic vesicle and mitochondrion
CC membrane in a calmodulin-dependent manner. {ECO:0000250}.
CC -!- ALTERNATIVE PRODUCTS:
CC Event=Alternative splicing; Named isoforms=2;
CC Name=Long;
CC IsoId=Q07816-1; Sequence=Displayed;
CC Name=Short;
CC IsoId=Q07816-2; Sequence=VSP_000514;
CC -!- TISSUE SPECIFICITY: Highest expression in organs with lymphoid
CC development.
CC -!- DOMAIN: The BH4 motif seems to be involved in the anti-apoptotic
CC function. Intact BH1 and BH2 motifs are required for anti-apoptotic
CC activity (By similarity). {ECO:0000250}.
CC -!- SIMILARITY: Belongs to the Bcl-2 family. {ECO:0000305}.
CC ---------------------------------------------------------------------------
CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
CC Distributed under the Creative Commons Attribution (CC BY 4.0) License
CC ---------------------------------------------------------------------------
DR EMBL; Z23110; CAA80657.1; -; Genomic_DNA.
DR EMBL; U26645; AAB07677.1; -; mRNA.
DR PIR; A47537; A47537.
DR RefSeq; NP_001020475.1; NM_001025304.1. [Q07816-1]
DR RefSeq; XP_015151803.1; XM_015296317.1. [Q07816-1]
DR RefSeq; XP_015151804.1; XM_015296318.1. [Q07816-1]
DR RefSeq; XP_015151805.1; XM_015296319.1. [Q07816-1]
DR RefSeq; XP_015151806.1; XM_015296320.1. [Q07816-1]
DR AlphaFoldDB; Q07816; -.
DR SMR; Q07816; -.
DR STRING; 9031.ENSGALP00000010012; -.
DR PaxDb; Q07816; -.
DR Ensembl; ENSGALT00000010026; ENSGALP00000010012; ENSGALG00000006211. [Q07816-1]
DR Ensembl; ENSGALT00000010073; ENSGALP00000010059; ENSGALG00000006211. [Q07816-1]
DR Ensembl; ENSGALT00000078202; ENSGALP00000054103; ENSGALG00000006211. [Q07816-1]
DR GeneID; 373954; -.
DR KEGG; gga:373954; -.
DR CTD; 598; -.
DR VEuPathDB; HostDB:geneid_373954; -.
DR eggNOG; KOG4728; Eukaryota.
DR GeneTree; ENSGT01050000244953; -.
DR HOGENOM; CLU_085401_0_1_1; -.
DR InParanoid; Q07816; -.
DR OMA; SPNRTDG; -.
DR OrthoDB; 1218929at2759; -.
DR PhylomeDB; Q07816; -.
DR TreeFam; TF315834; -.
DR Reactome; R-GGA-111453; BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.
DR Reactome; R-GGA-844455; The NLRP1 inflammasome.
DR Reactome; R-GGA-9648002; RAS processing.
DR PRO; PR:Q07816; -.
DR Proteomes; UP000000539; Chromosome 20.
DR Bgee; ENSGALG00000006211; Expressed in lung and 13 other tissues.
DR ExpressionAtlas; Q07816; baseline and differential.
DR GO; GO:0070161; C:anchoring junction; IEA:UniProtKB-KW.
DR GO; GO:0097136; C:Bcl-2 family protein complex; IEA:Ensembl.
DR GO; GO:0005813; C:centrosome; ISS:UniProtKB.
DR GO; GO:0005829; C:cytosol; IEA:UniProtKB-SubCell.
DR GO; GO:0005783; C:endoplasmic reticulum; IEA:Ensembl.
DR GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
DR GO; GO:0005759; C:mitochondrial matrix; IEA:UniProtKB-SubCell.
DR GO; GO:0005741; C:mitochondrial outer membrane; IBA:GO_Central.
DR GO; GO:0031965; C:nuclear membrane; IEA:UniProtKB-SubCell.
DR GO; GO:0030672; C:synaptic vesicle membrane; IEA:UniProtKB-SubCell.
DR GO; GO:0051434; F:BH3 domain binding; IEA:Ensembl.
DR GO; GO:0046982; F:protein heterodimerization activity; IBA:GO_Central.
DR GO; GO:0042803; F:protein homodimerization activity; IBA:GO_Central.
DR GO; GO:0019901; F:protein kinase binding; IEA:Ensembl.
DR GO; GO:0071839; P:apoptotic process in bone marrow cell; IEA:Ensembl.
DR GO; GO:0071312; P:cellular response to alkaloid; IEA:Ensembl.
DR GO; GO:0071230; P:cellular response to amino acid stimulus; IEA:Ensembl.
DR GO; GO:0071480; P:cellular response to gamma radiation; IEA:Ensembl.
DR GO; GO:0051607; P:defense response to virus; IEA:Ensembl.
DR GO; GO:0097048; P:dendritic cell apoptotic process; IEA:Ensembl.
DR GO; GO:0044565; P:dendritic cell proliferation; IEA:Ensembl.
DR GO; GO:0035234; P:ectopic germ cell programmed cell death; IEA:Ensembl.
DR GO; GO:0050673; P:epithelial cell proliferation; IEA:Ensembl.
DR GO; GO:0097192; P:extrinsic apoptotic signaling pathway in absence of ligand; IBA:GO_Central.
DR GO; GO:0009566; P:fertilization; IEA:Ensembl.
DR GO; GO:0007281; P:germ cell development; IEA:Ensembl.
DR GO; GO:0097284; P:hepatocyte apoptotic process; IEA:Ensembl.
DR GO; GO:0008630; P:intrinsic apoptotic signaling pathway in response to DNA damage; IBA:GO_Central.
DR GO; GO:0008584; P:male gonad development; IEA:Ensembl.
DR GO; GO:0070584; P:mitochondrion morphogenesis; IEA:Ensembl.
DR GO; GO:2000669; P:negative regulation of dendritic cell apoptotic process; IEA:Ensembl.
DR GO; GO:0051093; P:negative regulation of developmental process; IEA:Ensembl.
DR GO; GO:1902236; P:negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway; IEA:Ensembl.
DR GO; GO:1900118; P:negative regulation of execution phase of apoptosis; IEA:Ensembl.
DR GO; GO:1902042; P:negative regulation of extrinsic apoptotic signaling pathway via death domain receptors; IEA:Ensembl.
DR GO; GO:2001243; P:negative regulation of intrinsic apoptotic signaling pathway; IBA:GO_Central.
DR GO; GO:1902230; P:negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage; IEA:Ensembl.
DR GO; GO:0043524; P:negative regulation of neuron apoptotic process; IEA:Ensembl.
DR GO; GO:1903077; P:negative regulation of protein localization to plasma membrane; IEA:Ensembl.
DR GO; GO:2000242; P:negative regulation of reproductive process; IEA:Ensembl.
DR GO; GO:0051402; P:neuron apoptotic process; IEA:Ensembl.
DR GO; GO:0001541; P:ovarian follicle development; IEA:Ensembl.
DR GO; GO:0032946; P:positive regulation of mononuclear cell proliferation; IEA:Ensembl.
DR GO; GO:0032465; P:regulation of cytokinesis; ISS:UniProtKB.
DR GO; GO:0040008; P:regulation of growth; IEA:Ensembl.
DR GO; GO:0046902; P:regulation of mitochondrial membrane permeability; IEA:Ensembl.
DR GO; GO:0051881; P:regulation of mitochondrial membrane potential; IEA:Ensembl.
DR GO; GO:0001836; P:release of cytochrome c from mitochondria; IEA:Ensembl.
DR GO; GO:0046898; P:response to cycloheximide; IEA:Ensembl.
DR GO; GO:0034097; P:response to cytokine; IEA:Ensembl.
DR GO; GO:0007283; P:spermatogenesis; IEA:Ensembl.
DR CDD; cd06845; Bcl-2_like; 1.
DR Gene3D; 1.10.437.10; -; 1.
DR InterPro; IPR013279; Apop_reg_BclX.
DR InterPro; IPR036834; Bcl-2-like_sf.
DR InterPro; IPR046371; Bcl-2_BH1-3.
DR InterPro; IPR026298; Bcl-2_fam.
DR InterPro; IPR002475; Bcl2-like.
DR InterPro; IPR004725; Bcl2/BclX.
DR InterPro; IPR020717; Bcl2_BH1_motif_CS.
DR InterPro; IPR020726; Bcl2_BH2_motif_CS.
DR InterPro; IPR020728; Bcl2_BH3_motif_CS.
DR InterPro; IPR003093; Bcl2_BH4.
DR InterPro; IPR020731; Bcl2_BH4_motif_CS.
DR PANTHER; PTHR11256; PTHR11256; 1.
DR PANTHER; PTHR11256:SF12; PTHR11256:SF12; 1.
DR Pfam; PF00452; Bcl-2; 1.
DR Pfam; PF02180; BH4; 1.
DR PRINTS; PR01864; APOPREGBCLX.
DR PRINTS; PR01862; BCL2FAMILY.
DR SMART; SM00337; BCL; 1.
DR SMART; SM00265; BH4; 1.
DR SUPFAM; SSF56854; SSF56854; 1.
DR TIGRFAMs; TIGR00865; bcl-2; 1.
DR PROSITE; PS50062; BCL2_FAMILY; 1.
DR PROSITE; PS01080; BH1; 1.
DR PROSITE; PS01258; BH2; 1.
DR PROSITE; PS01259; BH3; 1.
DR PROSITE; PS01260; BH4_1; 1.
DR PROSITE; PS50063; BH4_2; 1.
PE 2: Evidence at transcript level;
KW Alternative splicing; Apoptosis; Cytoplasm; Cytoplasmic vesicle;
KW Cytoskeleton; Membrane; Mitochondrion; Nucleus; Reference proteome;
KW Synapse; Transmembrane; Transmembrane helix.
FT CHAIN 1..229
FT /note="Bcl-2-like protein 1"
FT /id="PRO_0000143061"
FT TRANSMEM 206..223
FT /note="Helical"
FT /evidence="ECO:0000255"
FT MOTIF 4..24
FT /note="BH4"
FT MOTIF 82..96
FT /note="BH3"
FT MOTIF 125..144
FT /note="BH1"
FT MOTIF 176..191
FT /note="BH2"
FT VAR_SEQ 185..229
FT /note="ERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK -> VRT
FT ALP (in isoform Short)"
FT /evidence="ECO:0000305"
FT /id="VSP_000514"
SQ SEQUENCE 229 AA; 25733 MW; A97D3A4D04C0E9DA CRC64;
MSSSNRELVI DFVSYKLSQR GHCWSELEEE DENRTDTAAE AEMDSVLNGS PSWHPPAGHV
VNGATVHRSS LEVHEIVRAS DVRQALRDAG DEFELRYRRA FSDLTSQLHI TPGTAYQSFE
QVVNELFHDG VNWGRIVAFF SFGGALCVES VDKEMRVLVG RIVSWMTTYL TDHLDPWIQE
NGGWERFVDL YGNNAAAELR KGQETFNKWL LTGATVAGVL LLGSLLSRK
