位置:首页 > 蛋白库 > SCRA_ARATH
SCRA_ARATH
ID   SCRA_ARATH              Reviewed;          62 AA.
AC   P0CG07;
DT   15-JUN-2010, integrated into UniProtKB/Swiss-Prot.
DT   15-JUN-2010, sequence version 1.
DT   03-AUG-2022, entry version 34.
DE   RecName: Full=Defensin-like protein A;
DE            Short=AtSCRA;
DE   AltName: Full=S locus cysteine-rich-like protein A;
DE   AltName: Full=S locus protein 11;
DE   Flags: Precursor;
GN   Name=SCRA; Synonyms=SCR1, SP11; OrderedLocusNames=At4g21364;
GN   ORFNames=T6K22;
OS   Arabidopsis thaliana (Mouse-ear cress).
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
OX   NCBI_TaxID=3702;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], FUNCTION, AND MUTAGENESIS OF
RP   56-ASP--ALA-62.
RC   STRAIN=cv. Columbia;
RX   PubMed=20400945; DOI=10.1038/nature08927;
RA   Tsuchimatsu T., Suwabe K., Shimizu-Inatsugi R., Isokawa S., Pavlidis P.,
RA   Stadler T., Suzuki G., Takayama S., Watanabe M., Shimizu K.K.;
RT   "Evolution of self-compatibility in Arabidopsis by a mutation in the male
RT   specificity gene.";
RL   Nature 464:1342-1346(2010).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RC   STRAIN=cv. Columbia;
RX   PubMed=10617198; DOI=10.1038/47134;
RA   Mayer K.F.X., Schueller C., Wambutt R., Murphy G., Volckaert G., Pohl T.,
RA   Duesterhoeft A., Stiekema W., Entian K.-D., Terryn N., Harris B.,
RA   Ansorge W., Brandt P., Grivell L.A., Rieger M., Weichselgartner M.,
RA   de Simone V., Obermaier B., Mache R., Mueller M., Kreis M., Delseny M.,
RA   Puigdomenech P., Watson M., Schmidtheini T., Reichert B., Portetelle D.,
RA   Perez-Alonso M., Boutry M., Bancroft I., Vos P., Hoheisel J.,
RA   Zimmermann W., Wedler H., Ridley P., Langham S.-A., McCullagh B.,
RA   Bilham L., Robben J., van der Schueren J., Grymonprez B., Chuang Y.-J.,
RA   Vandenbussche F., Braeken M., Weltjens I., Voet M., Bastiaens I., Aert R.,
RA   Defoor E., Weitzenegger T., Bothe G., Ramsperger U., Hilbert H., Braun M.,
RA   Holzer E., Brandt A., Peters S., van Staveren M., Dirkse W., Mooijman P.,
RA   Klein Lankhorst R., Rose M., Hauf J., Koetter P., Berneiser S., Hempel S.,
RA   Feldpausch M., Lamberth S., Van den Daele H., De Keyser A., Buysshaert C.,
RA   Gielen J., Villarroel R., De Clercq R., van Montagu M., Rogers J.,
RA   Cronin A., Quail M.A., Bray-Allen S., Clark L., Doggett J., Hall S.,
RA   Kay M., Lennard N., McLay K., Mayes R., Pettett A., Rajandream M.A.,
RA   Lyne M., Benes V., Rechmann S., Borkova D., Bloecker H., Scharfe M.,
RA   Grimm M., Loehnert T.-H., Dose S., de Haan M., Maarse A.C., Schaefer M.,
RA   Mueller-Auer S., Gabel C., Fuchs M., Fartmann B., Granderath K., Dauner D.,
RA   Herzl A., Neumann S., Argiriou A., Vitale D., Liguori R., Piravandi E.,
RA   Massenet O., Quigley F., Clabauld G., Muendlein A., Felber R., Schnabl S.,
RA   Hiller R., Schmidt W., Lecharny A., Aubourg S., Chefdor F., Cooke R.,
RA   Berger C., Monfort A., Casacuberta E., Gibbons T., Weber N., Vandenbol M.,
RA   Bargues M., Terol J., Torres A., Perez-Perez A., Purnelle B., Bent E.,
RA   Johnson S., Tacon D., Jesse T., Heijnen L., Schwarz S., Scholler P.,
RA   Heber S., Francs P., Bielke C., Frishman D., Haase D., Lemcke K.,
RA   Mewes H.-W., Stocker S., Zaccaria P., Bevan M., Wilson R.K.,
RA   de la Bastide M., Habermann K., Parnell L., Dedhia N., Gnoj L., Schutz K.,
RA   Huang E., Spiegel L., Sekhon M., Murray J., Sheet P., Cordes M.,
RA   Abu-Threideh J., Stoneking T., Kalicki J., Graves T., Harmon G.,
RA   Edwards J., Latreille P., Courtney L., Cloud J., Abbott A., Scott K.,
RA   Johnson D., Minx P., Bentley D., Fulton B., Miller N., Greco T., Kemp K.,
RA   Kramer J., Fulton L., Mardis E., Dante M., Pepin K., Hillier L.W.,
RA   Nelson J., Spieth J., Ryan E., Andrews S., Geisel C., Layman D., Du H.,
RA   Ali J., Berghoff A., Jones K., Drone K., Cotton M., Joshu C., Antonoiu B.,
RA   Zidanic M., Strong C., Sun H., Lamar B., Yordan C., Ma P., Zhong J.,
RA   Preston R., Vil D., Shekher M., Matero A., Shah R., Swaby I.K.,
RA   O'Shaughnessy A., Rodriguez M., Hoffman J., Till S., Granat S., Shohdy N.,
RA   Hasegawa A., Hameed A., Lodhi M., Johnson A., Chen E., Marra M.A.,
RA   Martienssen R., McCombie W.R.;
RT   "Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana.";
RL   Nature 402:769-777(1999).
RN   [3]
RP   GENOME REANNOTATION.
RC   STRAIN=cv. Columbia;
RX   PubMed=27862469; DOI=10.1111/tpj.13415;
RA   Cheng C.Y., Krishnakumar V., Chan A.P., Thibaud-Nissen F., Schobel S.,
RA   Town C.D.;
RT   "Araport11: a complete reannotation of the Arabidopsis thaliana reference
RT   genome.";
RL   Plant J. 89:789-804(2017).
RN   [4]
RP   FUNCTION.
RX   PubMed=15505209; DOI=10.1073/pnas.0406970101;
RA   Nasrallah M.E., Liu P., Sherman-Broyles S., Boggs N.A., Nasrallah J.B.;
RT   "Natural variation in expression of self-incompatibility in Arabidopsis
RT   thaliana: implications for the evolution of selfing.";
RL   Proc. Natl. Acad. Sci. U.S.A. 101:16070-16074(2004).
RN   [5]
RP   FUNCTION.
RX   PubMed=16782760; DOI=10.1093/molbev/msl042;
RA   Bechsgaard J.S., Castric V., Charlesworth D., Vekemans X., Schierup M.H.;
RT   "The transition to self-compatibility in Arabidopsis thaliana and evolution
RT   within S-haplotypes over 10 Myr.";
RL   Mol. Biol. Evol. 23:1741-1750(2006).
RN   [6]
RP   FUNCTION.
RX   PubMed=19300485; DOI=10.1371/journal.pgen.1000426;
RA   Boggs N.A., Nasrallah J.B., Nasrallah M.E.;
RT   "Independent S-locus mutations caused self-fertility in Arabidopsis
RT   thaliana.";
RL   PLoS Genet. 5:E1000426-E1000426(2009).
CC   -!- FUNCTION: Truncated and inactivated form of SCRA, a protein involved in
CC       male-mediated self-incompatibility when active. Most A.thaliana
CC       cultivars contain such an inactive form and thus, are self-fertiles.
CC       {ECO:0000269|PubMed:15505209, ECO:0000269|PubMed:16782760,
CC       ECO:0000269|PubMed:19300485, ECO:0000269|PubMed:20400945}.
CC   -!- SUBCELLULAR LOCATION: Secreted {ECO:0000250}.
CC   -!- MISCELLANEOUS: By contrast to A.lyrata and A.halleri, self-incompatible
CC       species with full-length SCRA isoforms, A.thaliana is self-compatible
CC       with impaired SCRA protein.
CC   -!- SIMILARITY: Belongs to the DEFL family. {ECO:0000305}.
CC   -!- WEB RESOURCE: Name=Protein Spotlight; Note=Do it yourself - Issue 128
CC       of May 2011;
CC       URL="https://web.expasy.org/spotlight/back_issues/128";
CC   ---------------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
CC   Distributed under the Creative Commons Attribution (CC BY 4.0) License
CC   ---------------------------------------------------------------------------
DR   EMBL; AL031187; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; CP002687; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   AlphaFoldDB; P0CG07; -.
DR   PRIDE; P0CG07; -.
DR   Araport; AT4G21364; -.
DR   PRO; PR:P0CG07; -.
DR   Proteomes; UP000006548; Chromosome 4.
DR   GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
DR   GO; GO:0060320; P:rejection of self pollen; IEA:UniProtKB-KW.
DR   GO; GO:0007165; P:signal transduction; IEA:InterPro.
DR   InterPro; IPR010682; SCRL.
DR   PANTHER; PTHR34450; PTHR34450; 1.
DR   Pfam; PF06876; SCRL; 1.
PE   1: Evidence at protein level;
KW   Disulfide bond; Reference proteome; Secreted; Self-incompatibility; Signal.
FT   SIGNAL          1..26
FT                   /evidence="ECO:0000255"
FT   CHAIN           27..62
FT                   /note="Defensin-like protein A"
FT                   /id="PRO_0000394667"
FT   DISULFID        42..52
FT                   /evidence="ECO:0000250"
FT   MUTAGEN         56..62
FT                   /note="DAKKTLA->IAKNFRPSRPFECNCQTFDKGGICYCKKCLV: Confers
FT                   male-driven self-incompatibility."
FT                   /evidence="ECO:0000269|PubMed:20400945"
SQ   SEQUENCE   62 AA;  7226 MW;  863A76970BCF46A9 CRC64;
     MRCVVLFMVS CLLIVLLINH FEEVEAQKWN KCFLRDIFPG KCEHDANAKL RCKEDDAKKT
     LA
 
 
维奥蛋白资源库 - 中文蛋白资源 CopyRight © 2010-2026