位置:首页 > 蛋白库 > WNT3A_HUMAN
WNT3A_HUMAN
ID   WNT3A_HUMAN             Reviewed;         352 AA.
AC   P56704; Q3SY79; Q3SY80; Q969P2;
DT   15-JUL-1999, integrated into UniProtKB/Swiss-Prot.
DT   10-MAY-2002, sequence version 2.
DT   03-AUG-2022, entry version 192.
DE   RecName: Full=Protein Wnt-3a;
DE   Flags: Precursor;
GN   Name=WNT3A;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND TISSUE SPECIFICITY.
RX   PubMed=11414706; DOI=10.1006/bbrc.2001.5105;
RA   Saitoh T., Hirai M., Katoh M.;
RT   "Molecular cloning and characterization of WNT3a and WNT14 clustered in
RT   human chromosome 1q42 region.";
RL   Biochem. Biophys. Res. Commun. 284:1168-1175(2001).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
RX   PubMed=14702039; DOI=10.1038/ng1285;
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
RA   Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
RA   Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
RA   Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
RA   Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
RA   Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
RA   Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
RA   Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
RA   Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
RA   Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
RA   Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
RA   Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
RA   Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
RA   Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
RA   Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
RA   Isogai T., Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs.";
RL   Nat. Genet. 36:40-45(2004).
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RX   PubMed=16710414; DOI=10.1038/nature04727;
RA   Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A.,
RA   Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C.,
RA   Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.,
RA   Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C.,
RA   Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W.,
RA   Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J.,
RA   Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J.,
RA   Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y.,
RA   Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J.,
RA   Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
RA   Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
RA   Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
RA   Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S.,
RA   Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K.,
RA   Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R.,
RA   Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M.,
RA   Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S.,
RA   Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J.,
RA   Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W.,
RA   McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
RA   Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
RA   Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
RA   Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
RA   Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S.,
RA   Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M.,
RA   White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H.,
RA   Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E.,
RA   Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G.,
RA   Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.;
RT   "The DNA sequence and biological annotation of human chromosome 1.";
RL   Nature 441:315-321(2006).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA project:
RT   the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [5]
RP   NUCLEOTIDE SEQUENCE [MRNA] OF 207-330.
RC   TISSUE=Mammary gland;
RX   PubMed=8168088;
RA   Huguet E.L., McMahon J.A., McMahon A.P., Bicknell R., Harris A.L.;
RT   "Differential expression of human Wnt genes 2, 3, 4, and 7B in human breast
RT   cell lines and normal and disease states of human breast tissue.";
RL   Cancer Res. 54:2615-2621(1994).
RN   [6]
RP   INTERACTION WITH GPC3.
RX   PubMed=16227623; DOI=10.1074/jbc.m507004200;
RA   Capurro M.I., Shi W., Sandal S., Filmus J.;
RT   "Processing by convertases is not required for glypican-3-induced
RT   stimulation of hepatocellular carcinoma growth.";
RL   J. Biol. Chem. 280:41201-41206(2005).
RN   [7]
RP   INTERACTION WITH WLS.
RX   PubMed=16678095; DOI=10.1016/j.cell.2006.02.049;
RA   Baenziger C., Soldini D., Schuett C., Zipperlen P., Hausmann G., Basler K.;
RT   "Wntless, a conserved membrane protein dedicated to the secretion of Wnt
RT   proteins from signaling cells.";
RL   Cell 125:509-522(2006).
RN   [8]
RP   INTERACTION WITH LRP6 IN THE WNT/FZD/LRP6 COMPLEX, AND FUNCTION.
RX   PubMed=20093360; DOI=10.1074/jbc.m109.092130;
RA   Bourhis E., Tam C., Franke Y., Bazan J.F., Ernst J., Hwang J., Costa M.,
RA   Cochran A.G., Hannoush R.N.;
RT   "Reconstitution of a frizzled8.Wnt3a.LRP6 signaling complex reveals
RT   multiple Wnt and Dkk1 binding sites on LRP6.";
RL   J. Biol. Chem. 285:9172-9179(2010).
RN   [9]
RP   PALMITOLEOYLATION AT SER-209 BY PORCN, AND MUTAGENESIS OF SER-209.
RX   PubMed=20826466; DOI=10.1242/jcs.072132;
RA   Coombs G.S., Yu J., Canning C.A., Veltri C.A., Covey T.M., Cheong J.K.,
RA   Utomo V., Banerjee N., Zhang Z.H., Jadulco R.C., Concepcion G.P.,
RA   Bugni T.S., Harper M.K., Mihalek I., Jones C.M., Ireland C.M.,
RA   Virshup D.M.;
RT   "WLS-dependent secretion of WNT3A requires Ser209 acylation and vacuolar
RT   acidification.";
RL   J. Cell Sci. 123:3357-3367(2010).
RN   [10]
RP   INTERACTION WITH APCDD1.
RX   PubMed=20393562; DOI=10.1038/nature08875;
RA   Shimomura Y., Agalliu D., Vonica A., Luria V., Wajid M., Baumer A.,
RA   Belli S., Petukhova L., Schinzel A., Brivanlou A.H., Barres B.A.,
RA   Christiano A.M.;
RT   "APCDD1 is a novel Wnt inhibitor mutated in hereditary hypotrichosis
RT   simplex.";
RL   Nature 464:1043-1047(2010).
RN   [11]
RP   FUNCTION, PRELIMINARY CYSTEINE PALMITOYLATION, PALMITOLEOYLATION AT
RP   SER-209, GLYCOSYLATION AT ASN-87 AND ASN-298, AND MUTAGENESIS OF ASN-87;
RP   SER-209 AND ASN-298.
RX   PubMed=21244856; DOI=10.1016/j.cellsig.2011.01.007;
RA   Doubravska L., Krausova M., Gradl D., Vojtechova M., Tumova L., Lukas J.,
RA   Valenta T., Pospichalova V., Fafilek B., Plachy J., Sebesta O., Korinek V.;
RT   "Fatty acid modification of Wnt1 and Wnt3a at serine is prerequisite for
RT   lipidation at cysteine and is essential for Wnt signalling.";
RL   Cell. Signal. 23:837-848(2011).
RN   [12]
RP   FUNCTION, SUBCELLULAR LOCATION, DISULFIDE BONDS, AND MUTAGENESIS OF
RP   SER-209; CYS-334 AND CYS-335.
RX   PubMed=24841207; DOI=10.1074/jbc.m114.575027;
RA   MacDonald B.T., Hien A., Zhang X., Iranloye O., Virshup D.M.,
RA   Waterman M.L., He X.;
RT   "Disulfide bond requirements for active wnt ligands.";
RL   J. Biol. Chem. 289:18122-18136(2014).
RN   [13]
RP   LACK OF PALMITOYLATION AT CYS-77, AND PALMITOLEOYLATION AT SER-209 BY
RP   PORCN.
RX   PubMed=24292069; DOI=10.1038/nchembio.1392;
RA   Gao X., Hannoush R.N.;
RT   "Single-cell imaging of Wnt palmitoylation by the acyltransferase
RT   porcupine.";
RL   Nat. Chem. Biol. 10:61-68(2014).
RN   [14]
RP   PALMITOLEOYLATION AT SER-209, AND DEPALMITOLEOYLATION.
RX   PubMed=25731175; DOI=10.1038/nature14259;
RA   Kakugawa S., Langton P.F., Zebisch M., Howell S.A., Chang T.H., Liu Y.,
RA   Feizi T., Bineva G., O'Reilly N., Snijders A.P., Jones E.Y., Vincent J.P.;
RT   "Notum deacylates Wnt proteins to suppress signalling activity.";
RL   Nature 519:187-192(2015).
RN   [15]
RP   INTERACTION WITH AFM, FUNCTION, AND SUBCELLULAR LOCATION.
RX   PubMed=26902720; DOI=10.7554/elife.11621;
RA   Mihara E., Hirai H., Yamamoto H., Tamura-Kawakami K., Matano M.,
RA   Kikuchi A., Sato T., Takagi J.;
RT   "Active and water-soluble form of lipidated Wnt protein is maintained by a
RT   serum glycoprotein afamin/alpha-albumin.";
RL   Elife 5:0-0(2016).
RN   [16]
RP   INTERACTION WITH PKD1.
RX   PubMed=27214281; DOI=10.1038/ncb3363;
RA   Kim S., Nie H., Nesin V., Tran U., Outeda P., Bai C.X., Keeling J.,
RA   Maskey D., Watnick T., Wessely O., Tsiokas L.;
RT   "The polycystin complex mediates Wnt/Ca(2+) signalling.";
RL   Nat. Cell Biol. 18:752-764(2016).
CC   -!- FUNCTION: Ligand for members of the frizzled family of seven
CC       transmembrane receptors (Probable). Functions in the canonical Wnt
CC       signaling pathway that results in activation of transcription factors
CC       of the TCF/LEF family (PubMed:20093360, PubMed:21244856,
CC       PubMed:24841207, PubMed:26902720). Required for normal embryonic
CC       mesoderm development and formation of caudal somites. Required for
CC       normal morphogenesis of the developing neural tube (By similarity).
CC       Mediates self-renewal of the stem cells at the bottom on intestinal
CC       crypts (in vitro) (PubMed:26902720). {ECO:0000250|UniProtKB:P27467,
CC       ECO:0000269|PubMed:20093360, ECO:0000269|PubMed:21244856,
CC       ECO:0000269|PubMed:24841207, ECO:0000269|PubMed:26902720, ECO:0000305}.
CC   -!- SUBUNIT: Forms a soluble 1:1 complex with AFM; this prevents
CC       oligomerization and is required for prolonged biological activity
CC       (PubMed:26902720). The complex with AFM may represent the physiological
CC       form in body fluids (PubMed:26902720). Homooligomer; disulfide-linked,
CC       leading to inactivation (By similarity). Interacts with PORCN
CC       (PubMed:20826466). Interacts with APCDD1 and WLS (PubMed:16678095,
CC       PubMed:20393562). Component of the Wnt-Fzd-LRP5-LRP6 signaling complex
CC       that contains a WNT protein, a FZD protein and LRP5 or LRP6. Interacts
CC       directly in the complex with LRP6 (PubMed:20093360). Interacts with
CC       glypican GPC3 (PubMed:16227623). Interacts with PKD1 (via extracellular
CC       domain) (PubMed:27214281). {ECO:0000250|UniProtKB:P27467,
CC       ECO:0000269|PubMed:16227623, ECO:0000269|PubMed:16678095,
CC       ECO:0000269|PubMed:20093360, ECO:0000269|PubMed:20393562,
CC       ECO:0000269|PubMed:24841207, ECO:0000269|PubMed:26902720,
CC       ECO:0000269|PubMed:27214281, ECO:0000305|PubMed:20826466}.
CC   -!- INTERACTION:
CC       P56704; Q8J025: APCDD1; NbExp=3; IntAct=EBI-6173037, EBI-2683489;
CC       P56704; Q9H461: FZD8; NbExp=2; IntAct=EBI-6173037, EBI-6254212;
CC       P56704; O75581: LRP6; NbExp=2; IntAct=EBI-6173037, EBI-910915;
CC       P56704; Q5T9L3: WLS; NbExp=4; IntAct=EBI-6173037, EBI-2868748;
CC   -!- SUBCELLULAR LOCATION: Secreted, extracellular space, extracellular
CC       matrix {ECO:0000250|UniProtKB:P27467}. Secreted
CC       {ECO:0000269|PubMed:24841207, ECO:0000269|PubMed:26902720}.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=1;
CC         IsoId=P56704-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=P56704-2; Sequence=VSP_046558;
CC   -!- TISSUE SPECIFICITY: Moderately expressed in placenta and at low levels
CC       in adult lung, spleen, and prostate. {ECO:0000269|PubMed:11414706}.
CC   -!- PTM: Palmitoleoylation by PORCN is required for efficient binding to
CC       frizzled receptors. Palmitoleoylation is required for proper
CC       trafficking to cell surface, vacuolar acidification is critical to
CC       release palmitoleoylated WNT3A from WLS in secretory vesicles
CC       (PubMed:20826466, PubMed:21244856, PubMed:24292069). Depalmitoleoylated
CC       by NOTUM, leading to inhibit Wnt signaling pathway, possibly by
CC       promoting disulfide bond formation and oligomerization
CC       (PubMed:25731175). {ECO:0000269|PubMed:20826466,
CC       ECO:0000269|PubMed:21244856, ECO:0000269|PubMed:24292069,
CC       ECO:0000269|PubMed:25731175}.
CC   -!- PTM: Proteolytic processing by TIKI1 and TIKI2 promotes oxidation and
CC       formation of large disulfide-bond oligomers, leading to inactivation of
CC       WNT3A. {ECO:0000250|UniProtKB:P27467}.
CC   -!- PTM: Disulfide bonds have critical and distinct roles in secretion and
CC       activity. Loss of each conserved cysteine in WNT3A results in high
CC       molecular weight oxidized Wnt oligomers, which are formed through
CC       inter-Wnt disulfide bonding. {ECO:0000269|PubMed:24841207}.
CC   -!- SIMILARITY: Belongs to the Wnt family. {ECO:0000305}.
CC   -!- CAUTION: A palmitoylation site was proposed at Cys-77, but it was later
CC       shown that this cysteine is engaged in a disulfide bond
CC       (PubMed:24292069). {ECO:0000269|PubMed:24292069}.
CC   ---------------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
CC   Distributed under the Creative Commons Attribution (CC BY 4.0) License
CC   ---------------------------------------------------------------------------
DR   EMBL; AB060284; BAB61052.1; -; mRNA.
DR   EMBL; AK056278; BAB71136.1; -; mRNA.
DR   EMBL; AL136379; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; BC103921; AAI03922.1; -; mRNA.
DR   EMBL; BC103922; AAI03923.1; -; mRNA.
DR   EMBL; BC103923; AAI03924.1; -; mRNA.
DR   CCDS; CCDS1564.1; -. [P56704-1]
DR   RefSeq; NP_149122.1; NM_033131.3. [P56704-1]
DR   PDB; 7DRT; EM; 2.20 A; A=1-352.
DR   PDBsum; 7DRT; -.
DR   AlphaFoldDB; P56704; -.
DR   SMR; P56704; -.
DR   BioGRID; 124599; 40.
DR   DIP; DIP-58592N; -.
DR   IntAct; P56704; 20.
DR   STRING; 9606.ENSP00000284523; -.
DR   BindingDB; P56704; -.
DR   ChEMBL; CHEMBL1255137; -.
DR   GlyGen; P56704; 2 sites.
DR   iPTMnet; P56704; -.
DR   PhosphoSitePlus; P56704; -.
DR   BioMuta; WNT3A; -.
DR   DMDM; 20532424; -.
DR   MassIVE; P56704; -.
DR   PaxDb; P56704; -.
DR   PeptideAtlas; P56704; -.
DR   PRIDE; P56704; -.
DR   ProteomicsDB; 56937; -. [P56704-1]
DR   Antibodypedia; 34658; 607 antibodies from 36 providers.
DR   DNASU; 89780; -.
DR   Ensembl; ENST00000284523.2; ENSP00000284523.1; ENSG00000154342.6. [P56704-1]
DR   GeneID; 89780; -.
DR   KEGG; hsa:89780; -.
DR   MANE-Select; ENST00000284523.2; ENSP00000284523.1; NM_033131.4; NP_149122.1.
DR   UCSC; uc001hrq.3; human. [P56704-1]
DR   CTD; 89780; -.
DR   DisGeNET; 89780; -.
DR   GeneCards; WNT3A; -.
DR   HGNC; HGNC:15983; WNT3A.
DR   HPA; ENSG00000154342; Tissue enriched (placenta).
DR   MalaCards; WNT3A; -.
DR   MIM; 606359; gene.
DR   neXtProt; NX_P56704; -.
DR   OpenTargets; ENSG00000154342; -.
DR   Orphanet; 85193; Idiopathic juvenile osteoporosis.
DR   PharmGKB; PA38074; -.
DR   VEuPathDB; HostDB:ENSG00000154342; -.
DR   eggNOG; KOG3913; Eukaryota.
DR   GeneTree; ENSGT00940000160510; -.
DR   HOGENOM; CLU_033039_1_0_1; -.
DR   InParanoid; P56704; -.
DR   OMA; GLTHVMA; -.
DR   OrthoDB; 965867at2759; -.
DR   PhylomeDB; P56704; -.
DR   TreeFam; TF105310; -.
DR   PathwayCommons; P56704; -.
DR   Reactome; R-HSA-201681; TCF dependent signaling in response to WNT.
DR   Reactome; R-HSA-3238698; WNT ligand biogenesis and trafficking.
DR   Reactome; R-HSA-373080; Class B/2 (Secretin family receptors).
DR   Reactome; R-HSA-3772470; Negative regulation of TCF-dependent signaling by WNT ligand antagonists.
DR   Reactome; R-HSA-4641262; Disassembly of the destruction complex and recruitment of AXIN to the membrane.
DR   Reactome; R-HSA-4641263; Regulation of FZD by ubiquitination.
DR   Reactome; R-HSA-5340588; Signaling by RNF43 mutants.
DR   SignaLink; P56704; -.
DR   SIGNOR; P56704; -.
DR   BioGRID-ORCS; 89780; 14 hits in 1072 CRISPR screens.
DR   ChiTaRS; WNT3A; human.
DR   GeneWiki; WNT3A; -.
DR   GenomeRNAi; 89780; -.
DR   Pharos; P56704; Tchem.
DR   PRO; PR:P56704; -.
DR   Proteomes; UP000005640; Chromosome 1.
DR   RNAct; P56704; protein.
DR   Bgee; ENSG00000154342; Expressed in placenta and 24 other tissues.
DR   GO; GO:0009986; C:cell surface; ISS:BHF-UCL.
DR   GO; GO:0031901; C:early endosome membrane; TAS:Reactome.
DR   GO; GO:0030666; C:endocytic vesicle membrane; TAS:Reactome.
DR   GO; GO:0005788; C:endoplasmic reticulum lumen; TAS:Reactome.
DR   GO; GO:0070062; C:extracellular exosome; TAS:Reactome.
DR   GO; GO:0005576; C:extracellular region; TAS:Reactome.
DR   GO; GO:0005615; C:extracellular space; IDA:UniProtKB.
DR   GO; GO:0098978; C:glutamatergic synapse; IDA:SynGO.
DR   GO; GO:0005796; C:Golgi lumen; TAS:Reactome.
DR   GO; GO:0005886; C:plasma membrane; TAS:Reactome.
DR   GO; GO:0098793; C:presynapse; IEA:GOC.
DR   GO; GO:1990851; C:Wnt-Frizzled-LRP5/6 complex; IDA:ParkinsonsUK-UCL.
DR   GO; GO:0039706; F:co-receptor binding; IPI:ParkinsonsUK-UCL.
DR   GO; GO:0005125; F:cytokine activity; IBA:GO_Central.
DR   GO; GO:0005109; F:frizzled binding; IBA:GO_Central.
DR   GO; GO:0019904; F:protein domain specific binding; IEA:Ensembl.
DR   GO; GO:0048018; F:receptor ligand activity; IDA:BHF-UCL.
DR   GO; GO:0005102; F:signaling receptor binding; IPI:ParkinsonsUK-UCL.
DR   GO; GO:0003713; F:transcription coactivator activity; IEA:Ensembl.
DR   GO; GO:0090245; P:axis elongation involved in somitogenesis; IEA:Ensembl.
DR   GO; GO:0007411; P:axon guidance; IEA:Ensembl.
DR   GO; GO:0042100; P:B cell proliferation; IEA:Ensembl.
DR   GO; GO:0090676; P:calcium ion transmembrane transport via low voltage-gated calcium channel; IEA:Ensembl.
DR   GO; GO:0060070; P:canonical Wnt signaling pathway; IDA:UniProtKB.
DR   GO; GO:0061317; P:canonical Wnt signaling pathway involved in cardiac muscle cell fate commitment; IDA:BHF-UCL.
DR   GO; GO:0045165; P:cell fate commitment; IBA:GO_Central.
DR   GO; GO:0008283; P:cell population proliferation; IMP:UniProtKB.
DR   GO; GO:0021846; P:cell proliferation in forebrain; ISS:BHF-UCL.
DR   GO; GO:0033278; P:cell proliferation in midbrain; TAS:ParkinsonsUK-UCL.
DR   GO; GO:0071300; P:cellular response to retinoic acid; ISS:UniProtKB.
DR   GO; GO:0010387; P:COP9 signalosome assembly; ISS:BHF-UCL.
DR   GO; GO:0021904; P:dorsal/ventral neural tube patterning; IEA:Ensembl.
DR   GO; GO:0030198; P:extracellular matrix organization; IEA:Ensembl.
DR   GO; GO:0045444; P:fat cell differentiation; IEA:Ensembl.
DR   GO; GO:0001947; P:heart looping; IEA:Ensembl.
DR   GO; GO:0030097; P:hemopoiesis; IEA:Ensembl.
DR   GO; GO:0021766; P:hippocampus development; IEA:Ensembl.
DR   GO; GO:0001701; P:in utero embryonic development; IEA:Ensembl.
DR   GO; GO:0042472; P:inner ear morphogenesis; IEA:Ensembl.
DR   GO; GO:0030879; P:mammary gland development; IEA:Ensembl.
DR   GO; GO:0050804; P:modulation of chemical synaptic transmission; IEA:Ensembl.
DR   GO; GO:0045445; P:myoblast differentiation; IEA:Ensembl.
DR   GO; GO:0048843; P:negative regulation of axon extension involved in axon guidance; IEA:Ensembl.
DR   GO; GO:1904339; P:negative regulation of dopaminergic neuron differentiation; IEA:Ensembl.
DR   GO; GO:0045599; P:negative regulation of fat cell differentiation; IEA:Ensembl.
DR   GO; GO:0003136; P:negative regulation of heart induction by canonical Wnt signaling pathway; IDA:BHF-UCL.
DR   GO; GO:0050768; P:negative regulation of neurogenesis; ISS:BHF-UCL.
DR   GO; GO:1901215; P:negative regulation of neuron death; IEA:Ensembl.
DR   GO; GO:0010977; P:negative regulation of neuron projection development; ISS:UniProtKB.
DR   GO; GO:0030182; P:neuron differentiation; ISS:UniProtKB.
DR   GO; GO:0001649; P:osteoblast differentiation; IEA:Ensembl.
DR   GO; GO:0048343; P:paraxial mesodermal cell fate commitment; IEA:Ensembl.
DR   GO; GO:0070527; P:platelet aggregation; IEA:Ensembl.
DR   GO; GO:0030890; P:positive regulation of B cell proliferation; IEA:Ensembl.
DR   GO; GO:0090263; P:positive regulation of canonical Wnt signaling pathway; IDA:BHF-UCL.
DR   GO; GO:2000081; P:positive regulation of canonical Wnt signaling pathway involved in controlling type B pancreatic cell proliferation; IEA:Ensembl.
DR   GO; GO:2000727; P:positive regulation of cardiac muscle cell differentiation; IDA:BHF-UCL.
DR   GO; GO:0008284; P:positive regulation of cell population proliferation; ISS:BHF-UCL.
DR   GO; GO:2000049; P:positive regulation of cell-cell adhesion mediated by cadherin; IEA:Ensembl.
DR   GO; GO:0048697; P:positive regulation of collateral sprouting in absence of injury; IEA:Ensembl.
DR   GO; GO:0043280; P:positive regulation of cysteine-type endopeptidase activity involved in apoptotic process; IEA:Ensembl.
DR   GO; GO:0001819; P:positive regulation of cytokine production; IEA:Ensembl.
DR   GO; GO:0061184; P:positive regulation of dermatome development; IDA:BHF-UCL.
DR   GO; GO:0051091; P:positive regulation of DNA-binding transcription factor activity; IEA:Ensembl.
DR   GO; GO:0010628; P:positive regulation of gene expression; IDA:BHF-UCL.
DR   GO; GO:2000347; P:positive regulation of hepatocyte proliferation; IEA:Ensembl.
DR   GO; GO:0048337; P:positive regulation of mesodermal cell fate specification; IDA:BHF-UCL.
DR   GO; GO:2000179; P:positive regulation of neural precursor cell proliferation; IEA:Ensembl.
DR   GO; GO:0033138; P:positive regulation of peptidyl-serine phosphorylation; IDA:BHF-UCL.
DR   GO; GO:0032092; P:positive regulation of protein binding; IDA:BHF-UCL.
DR   GO; GO:1903078; P:positive regulation of protein localization to plasma membrane; IEA:Ensembl.
DR   GO; GO:0001934; P:positive regulation of protein phosphorylation; IDA:BHF-UCL.
DR   GO; GO:0061098; P:positive regulation of protein tyrosine kinase activity; IEA:Ensembl.
DR   GO; GO:0002092; P:positive regulation of receptor internalization; IDA:BHF-UCL.
DR   GO; GO:0048643; P:positive regulation of skeletal muscle tissue development; IEA:Ensembl.
DR   GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; IDA:BHF-UCL.
DR   GO; GO:0045893; P:positive regulation of transcription, DNA-templated; ISS:BHF-UCL.
DR   GO; GO:0036342; P:post-anal tail morphogenesis; IEA:Ensembl.
DR   GO; GO:0099527; P:postsynapse to nucleus signaling pathway; IEA:Ensembl.
DR   GO; GO:0099054; P:presynapse assembly; TAS:ParkinsonsUK-UCL.
DR   GO; GO:0008104; P:protein localization; IEA:Ensembl.
DR   GO; GO:0070507; P:regulation of microtubule cytoskeleton organization; IEA:Ensembl.
DR   GO; GO:1905606; P:regulation of presynapse assembly; IDA:SynGO.
DR   GO; GO:0050807; P:regulation of synapse organization; IDA:SynGO.
DR   GO; GO:0062009; P:secondary palate development; IMP:BHF-UCL.
DR   GO; GO:0035914; P:skeletal muscle cell differentiation; IEA:Ensembl.
DR   GO; GO:0048103; P:somatic stem cell division; IEA:Ensembl.
DR   GO; GO:0021527; P:spinal cord association neuron differentiation; IEA:Ensembl.
DR   GO; GO:0036465; P:synaptic vesicle recycling; TAS:ParkinsonsUK-UCL.
DR   GO; GO:0006366; P:transcription by RNA polymerase II; IEA:Ensembl.
DR   GO; GO:0021874; P:Wnt signaling pathway involved in forebrain neuroblast division; IEA:Ensembl.
DR   GO; GO:1904953; P:Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation; TAS:ParkinsonsUK-UCL.
DR   Gene3D; 3.30.2460.20; -; 1.
DR   InterPro; IPR005817; Wnt.
DR   InterPro; IPR009141; Wnt3.
DR   InterPro; IPR043158; Wnt_C.
DR   InterPro; IPR018161; Wnt_CS.
DR   PANTHER; PTHR12027; PTHR12027; 1.
DR   Pfam; PF00110; wnt; 1.
DR   PRINTS; PR01843; WNT3PROTEIN.
DR   PRINTS; PR01349; WNTPROTEIN.
DR   SMART; SM00097; WNT1; 1.
DR   PROSITE; PS00246; WNT1; 1.
PE   1: Evidence at protein level;
KW   3D-structure; Alternative splicing; Developmental protein; Disulfide bond;
KW   Extracellular matrix; Glycoprotein; Lipoprotein; Reference proteome;
KW   Secreted; Signal; Wnt signaling pathway.
FT   SIGNAL          1..18
FT                   /evidence="ECO:0000255"
FT   CHAIN           19..352
FT                   /note="Protein Wnt-3a"
FT                   /id="PRO_0000041418"
FT   SITE            26..27
FT                   /note="Cleavage; by TIKI1 and TIKI2"
FT                   /evidence="ECO:0000250|UniProtKB:P27467"
FT   LIPID           209
FT                   /note="O-palmitoleoyl serine; by PORCN"
FT                   /evidence="ECO:0000269|PubMed:20826466,
FT                   ECO:0000269|PubMed:21244856, ECO:0000269|PubMed:24292069,
FT                   ECO:0000269|PubMed:25731175"
FT   CARBOHYD        87
FT                   /note="N-linked (GlcNAc...) asparagine"
FT                   /evidence="ECO:0000269|PubMed:21244856"
FT   CARBOHYD        298
FT                   /note="N-linked (GlcNAc...) asparagine"
FT                   /evidence="ECO:0000269|PubMed:21244856"
FT   DISULFID        77..88
FT                   /evidence="ECO:0000269|PubMed:24292069"
FT   DISULFID        128..136
FT                   /evidence="ECO:0000250|UniProtKB:P28026"
FT   DISULFID        138..155
FT                   /evidence="ECO:0000250|UniProtKB:P28026"
FT   DISULFID        203..217
FT                   /evidence="ECO:0000250|UniProtKB:P28026"
FT   DISULFID        205..212
FT                   /evidence="ECO:0000250|UniProtKB:P28026"
FT   DISULFID        281..312
FT                   /evidence="ECO:0000250|UniProtKB:P28026"
FT   DISULFID        297..307
FT                   /evidence="ECO:0000250|UniProtKB:P28026"
FT   DISULFID        311..351
FT                   /evidence="ECO:0000250|UniProtKB:P28026"
FT   DISULFID        327..342
FT                   /evidence="ECO:0000250|UniProtKB:P28026"
FT   DISULFID        329..339
FT                   /evidence="ECO:0000250|UniProtKB:P28026"
FT   DISULFID        334..335
FT                   /evidence="ECO:0000250|UniProtKB:P28026"
FT   VAR_SEQ         352
FT                   /note="K -> KNPGSRAGNSAHQPPHPQPPVRFHPPLRRAGKVP (in isoform
FT                   2)"
FT                   /evidence="ECO:0000303|PubMed:15489334"
FT                   /id="VSP_046558"
FT   MUTAGEN         87
FT                   /note="N->Q: Strongly reduced ability to stimulate Wnt-
FT                   responsive reporters; when associated with Q-298."
FT                   /evidence="ECO:0000269|PubMed:21244856"
FT   MUTAGEN         209
FT                   /note="S->A: Abrogates WLS binding."
FT                   /evidence="ECO:0000269|PubMed:20826466,
FT                   ECO:0000269|PubMed:21244856, ECO:0000269|PubMed:24841207"
FT   MUTAGEN         209
FT                   /note="S->A: Complete loss of palmitoleoylation."
FT                   /evidence="ECO:0000269|PubMed:20826466,
FT                   ECO:0000269|PubMed:21244856, ECO:0000269|PubMed:24841207"
FT   MUTAGEN         209
FT                   /note="S->T: No effect on palmitoleoylation and secretion;
FT                   the threonine can functionally replace the serine."
FT                   /evidence="ECO:0000269|PubMed:20826466,
FT                   ECO:0000269|PubMed:21244856, ECO:0000269|PubMed:24841207"
FT   MUTAGEN         298
FT                   /note="N->Q: Strongly reduced ability to stimulate Wnt-
FT                   responsive reporters; when associated with Q-87."
FT                   /evidence="ECO:0000269|PubMed:21244856"
FT   MUTAGEN         334
FT                   /note="C->A: No signaling activity despite the presence of
FT                   significant amounts of secreted monomeric Wnt3a, exhibits
FT                   dominant negative properties; when associated with A-335."
FT                   /evidence="ECO:0000269|PubMed:24841207"
FT   MUTAGEN         335
FT                   /note="C->A: No signaling activity despite the presence of
FT                   significant amounts of secreted monomeric Wnt3a, exhibits
FT                   dominant negative properties; when associated with A-334."
FT                   /evidence="ECO:0000269|PubMed:24841207"
FT   HELIX           23..27
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   HELIX           29..31
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          35..38
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          42..44
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   HELIX           50..58
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   HELIX           63..80
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   TURN            81..83
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          94..96
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   HELIX           100..103
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   HELIX           107..129
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          134..137
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          145..148
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   TURN            150..153
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   HELIX           161..169
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   HELIX           170..172
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          176..178
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   HELIX           179..197
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          200..207
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          210..220
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   HELIX           224..237
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          239..246
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          248..251
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          253..258
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   TURN            260..262
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          267..269
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   TURN            285..288
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          300..304
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   HELIX           307..310
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          312..314
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          319..328
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          333..335
FT                   /evidence="ECO:0007829|PDB:7DRT"
FT   STRAND          340..348
FT                   /evidence="ECO:0007829|PDB:7DRT"
SQ   SEQUENCE   352 AA;  39365 MW;  A317BD6D4A73920B CRC64;
     MAPLGYFLLL CSLKQALGSY PIWWSLAVGP QYSSLGSQPI LCASIPGLVP KQLRFCRNYV
     EIMPSVAEGI KIGIQECQHQ FRGRRWNCTT VHDSLAIFGP VLDKATRESA FVHAIASAGV
     AFAVTRSCAE GTAAICGCSS RHQGSPGKGW KWGGCSEDIE FGGMVSREFA DARENRPDAR
     SAMNRHNNEA GRQAIASHMH LKCKCHGLSG SCEVKTCWWS QPDFRAIGDF LKDKYDSASE
     MVVEKHRESR GWVETLRPRY TYFKVPTERD LVYYEASPNF CEPNPETGSF GTRDRTCNVS
     SHGIDGCDLL CCGRGHNARA ERRREKCRCV FHWCCYVSCQ ECTRVYDVHT CK
 
 
维奥蛋白资源库 - 中文蛋白资源 CopyRight © 2010-2024